(data stored in ACNUC7421 zone)

EMBL: CP001630.PE584

CP001630.PE584       Location/Qualifiers
FT   CDS_pept        655826..657403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0594"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; KEGG: nha:Nham_3708 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34558"
FT                   /db_xref="GOA:C6WJC6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC6"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34558.1"
FT                   /translation="MSYVRRQLGKDLCALLDLVEGGTASDERLRAVALVAIDAEQLVSD
FT                   ESGRKELLALLPADKQLELAKRLDADTSGPKNVLNAVNDLTWTIEQRRELLEFLGFTID
FT                   RAPTRTPLFRQDAEPLYGLFPHQRRAAARIKELIYDGPRRAVLHLPTGVGKTRTGMNLI
FT                   CDHLRDREPTLVVWLAHGQELLEQAAAEFEHAWSQLGNRPVSVVRMWGNAPTTLDDVAD
FT                   GVVILGLEKAVSAAKGSPEFLHTLASRSSLTVFDEAHQIIAPTFQRVVDALTIRPDASL
FT                   LGLTATPGRTWADIAQDERLSDFFLRQKVMLEIEGYSNPVTALIDQGYLAKPTMRTVAS
FT                   DAGLHLSARDRQMLARSFDIPAGIVDALAHDEQWNLKVVQTIMDLLAREHRRILVFAAS
FT                   VDHCRLIAAVLSAVSLDAEFITGESSPRHRKQVITRFKGTGRRPMILCNFGVLTTGFDA
FT                   PAASAAVIARPTKSLVLYSQMVGRVIRGPKAGGTSTCEIVTVVDPELPGFGDVAEAFTN
FT                   WEDVWEPA"
     atgtcgtatg tccgcaggca gctcggcaag gacctgtgtg ccctgctaga cctcgtcgag        60
     ggaggcaccg catcggacga acggctgcgc gcggtcgccc tggtggccat cgacgcggag       120
     cagctcgtgt ccgacgagtc cggacgcaag gagctgctcg ctctgctgcc ggccgacaag       180
     cagcttgagt tggcgaagcg gctcgacgcg gacacgtctg gcccgaagaa cgttctgaac       240
     gcagtcaacg atctgacatg gacgatcgaa cagcgacgcg agctgctgga gtttctgggc       300
     ttcaccatcg accgggcgcc cactcggacg ccgctgttcc ggcaggacgc tgagccgctc       360
     tacggcctgt tcccacatca gcgccgcgcc gccgcacgga tcaaggagct gatctacgac       420
     gggccgcgcc gcgccgtact tcacctgccc accggtgtcg gcaaaacacg gaccggcatg       480
     aacctgatct gcgaccacct ccgcgaccgc gagcccaccc tcgttgtgtg gctcgctcat       540
     ggacaggagc tgttggagca ggccgcggca gagttcgaac acgcgtggtc gcagctcggt       600
     aaccgtccgg tgtccgtggt gcgcatgtgg ggcaacgcgc ccacgacact cgacgacgtc       660
     gcggacgggg tggtgatcct cgggctggag aaggccgtgt cggcggcgaa gggcagcccc       720
     gagttcctgc acactcttgc ttcgcgcagc agtctcacgg tgttcgacga agcgcatcag       780
     atcatcgcgc ccacgttcca gcgtgtcgtg gatgccctta ccatccgccc ggacgccagt       840
     ctgctggggt tgaccgccac tccgggacga acttgggccg acatcgcgca ggacgagcgg       900
     ttgtcggact ttttcttgcg gcagaaggtg atgctggaga tcgagggtta cagcaaccct       960
     gtcaccgcac tgatcgacca gggctatctg gccaagccga caatgagaac agtggcatcg      1020
     gacgcgggcc tgcacctatc tgcccgtgat cgtcaaatgc tcgcccgctc gttcgacatc      1080
     cccgcaggca tcgtggacgc gctggcccat gatgagcaat ggaaccttaa ggtcgtgcag      1140
     acgatcatgg atctgctggc gcgggagcac cgccggatcc tcgtgttcgc cgcctcggtg      1200
     gatcactgcc gactgatcgc cgctgtgctg tccgcggtca gcctcgacgc cgagttcata      1260
     accggcgagt cctcgccacg gcaccgaaag caggtcatca cccgcttcaa gggcacgggg      1320
     cgccgcccga tgatcctgtg caacttcggc gtattgacta ccggtttcga cgctcctgcc      1380
     gcgagcgccg ccgtcatcgc ccggccgacc aaatcgctgg tgctctacag tcagatggtc      1440
     gggcgggtca tccgcgggcc gaaagccggc ggaacctcca cttgcgagat cgtcaccgtc      1500
     gtggatcccg agctgccggg gttcggcgac gtggcggagg cattcaccaa ctgggaagat      1560
     gtatgggagc ccgcgtga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page