(data stored in ACNUC7421 zone)

EMBL: CP001630.PE585

CP001630.PE585       Location/Qualifiers
FT   CDS_pept        657388..659277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0595"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34559.1"
FT                   /translation="MGARVTSDDSNYRIVTPALTVKAMRDSGYKNTAYALAELIDNSID
FT                   AGATLVEVFACESPVQVSSRTRQRVETIAVLDNGKGMDSETLRRALKYGDGLGDDRKRI
FT                   GRFGMGLPNSSMSQCTRVEVWSWTNGPGNALYTYLDLAEINDGRDAVPDPIHVQGGVPE
FT                   YWRDLSDGLLSDTGTLVVWRNLDRVNWYGAAATLKNTSELIGRVYRHFLHEDKVDIRMA
FT                   PVRDGEVVAGAYYAAPNDPLYLMKSTCAPTPFDDKPMFEPFNMGNENEPGVTYFPITVE
FT                   GIEHKVKVRAAIARPEARRPDVADHPWPAGASPNKDAGNHPWGKHAGRNIGISLVRQGR
FT                   ELDLDSSWAIGYDPVERWWGVEVEFPPALDEIFGVTNNKQTATIFSSLAHFDWQAEAEA
FT                   DETFKAFKDRLAELGDPRLQLFDLALYLETKLLRTMRRQLKQQTVGRRKSKKRHDDEVT
FT                   SKATDAVKRRRDEGHTGKTDQLEDGVTNQDKRQEQVDALTQRHHLDEDTAQSMVDEALE
FT                   KDWRVRWISSYQDTHAFFSIDLMAGMLQVIFNNSHPLHDQLLAVLEEVPEDATDSDLKY
FT                   RLRRAADTFKLLLFSWARMEDEIPNDRQREKIADARRDWGRYARDFIDGEADE"
     atgggagccc gcgtgaccag cgatgacagc aattaccgga tcgtcacccc cgcgctgaca        60
     gtcaaggcaa tgcgtgacag cggctacaag aacaccgcct acgcgctcgc cgagctgatc       120
     gacaacagta ttgatgctgg cgccacgctg gtggaggtct tcgcctgcga aagtcccgta       180
     caggtctcct cccgcacaag gcagcgagtc gagaccatcg ctgtgctcga caacggcaag       240
     ggcatggact ccgagacact gcgtcgtgcc ctcaagtatg gcgacggcct cggcgacgat       300
     cgtaagcgca tcggccgatt cggcatgggc ttgccgaact ccagcatgtc gcagtgcacc       360
     agggttgagg tctggtcttg gaccaacggt cctggaaacg ccctctacac ctacctcgac       420
     cttgcagaga tcaacgacgg ccgtgacgcc gtgcccgacc cgatccacgt tcagggtggc       480
     gttccggagt actggcgcga tctcagcgac ggtcttctca gcgacaccgg aacccttgtt       540
     gtgtggagga acctcgatcg ggtcaactgg tacggcgctg cggcaaccct gaagaacacg       600
     tcggaactca tcggtcgcgt ctaccggcac ttcctccacg aagacaaggt cgacatccgg       660
     atggcccccg tgcgagacgg cgaggtggta gccggcgcct actacgccgc gcccaatgac       720
     cctctctatc tgatgaagtc gacctgcgcg ccgacgccgt tcgacgacaa gcccatgttc       780
     gagccgttca acatgggcaa cgagaatgag cccggtgtca cgtattttcc gatcaccgtc       840
     gagggaatag agcataaggt caaggtgcgt gccgccatcg ctcggcccga ggcgcgacgg       900
     ccagacgtgg ctgatcatcc ctggcccgca ggcgcaagtc ctaacaagga tgccggtaat       960
     catccttggg gcaagcatgc gggccgcaac atcggcatct ccttggtccg tcagggacgt      1020
     gaactcgatc tggattcgtc ctgggcgatt gggtatgacc cggtggagcg gtggtgggga      1080
     gtcgaggttg agttccctcc ggcgctagac gagatcttcg gtgtcacgaa caacaagcag      1140
     acggctacga tcttctcgtc gctcgcccac ttcgactggc aagccgaagc ggaggccgat      1200
     gagaccttca aggcgttcaa ggaccgcctc gcggagctcg gggacccccg cctgcaactg      1260
     ttcgaccttg ctctttacct cgaaaccaag ctcctacgca ccatgcgccg tcagctcaag      1320
     cagcagacag ttggccggcg taagagcaag aagcggcatg acgacgaggt cacgtccaaa      1380
     gcaacggatg cggtgaagcg caggcgggac gaaggccaca ccggcaagac cgaccagctc      1440
     gaggacggcg tcaccaacca ggacaagcgt caggaacagg tggacgctct tacccagcga      1500
     catcaccttg acgaagacac tgcacaatcc atggtcgacg aggcgctgga gaaggactgg      1560
     cgtgtgcggt ggatctccag ctaccaggac acgcacgcct tcttcagcat cgacctcatg      1620
     gcaggcatgc tccaagtgat cttcaacaac agtcatccgc tacatgatca gttgcttgcg      1680
     gttcttgagg aagtccctga ggatgcaacc gatagcgacc tgaagtaccg cctgcgtcgt      1740
     gcagccgaca ccttcaaatt gctgctgttc tcctgggctc ggatggagga cgagatcccc      1800
     aacgacaggc aacgggagaa gatcgccgac gcgcgccggg actggggacg ctacgcccgt      1860
     gacttcatcg acggtgaggc cgacgagtga                                       1890
//

If you have problems or comments...

PBIL Back to PBIL home page