(data stored in ACNUC7421 zone)

EMBL: CP001630.PE586

CP001630.PE586       Location/Qualifiers
FT   CDS_pept        659274..660161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB2173 bifunctional riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34560"
FT                   /db_xref="GOA:C6WJC8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34560.1"
FT                   /translation="MTEPDHVWRQIEVLLRSAGATALLVAPFIKKRVFEAALAVIPPSV
FT                   QRIDCVTRWTPSEVAAGVSDPEILDAANKDGRVHVALCPSLHAKIYSVDDRCLIGSANL
FT                   TAKATGLAPEANIELLIEAPASHPEVQRVVSELKAAAIPATTHMAALVRQQAELLTADG
FT                   ASEPRPAVSWYPVTRRPETLFTFYSGRSRFAEAVEAGLVQDLALLNIPAGLSEPQFNTA
FT                   VHDRLHAIPELRKLLNGQPLSNTELRHAIEERADVTEGQAHRITEIIAAWLKHFGSYYT
FT                   EVGSWELRHGRELG"
     gtgaccgaac ccgaccacgt ctggcgtcaa atcgaggtac tgctgcgcag cgccggggcc        60
     acggcgctgc tcgtggcccc cttcatcaag aagagggtct tcgaggctgc gctggccgtg       120
     atcccaccgt ccgtccagcg aatcgactgc gtgactcgct ggaccccatc tgaggtagca       180
     gccggggtct ccgacccgga gatcttggac gcagcgaaca aagacgggcg tgtgcatgtt       240
     gcgctctgcc cgtctttaca tgccaagatc tacagcgttg acgatcgctg cctgatcggt       300
     tcagcgaatc tgaccgccaa ggcaacaggg ctcgcgccag aagcgaatat cgagctgctg       360
     atcgaagcac ctgcgtccca ccccgaggtc cagcgtgttg tgagtgaact caaagcagcc       420
     gcgattccag ccactacgca catggccgct cttgttcggc agcaagccga gctgctcacc       480
     gcagacggcg catcggaacc gcgaccagcc gtctcgtggt acccggtaac tcgacgtccg       540
     gaaacgttgt tcacgttcta ctctggacga tcgcgcttcg cggaagccgt tgaggcaggt       600
     ctagttcagg atctcgcact actgaacatt cccgccggcc tgtccgagcc tcagttcaac       660
     accgcggtgc acgatcgact acacgcgatt cccgaactac gaaagcttct gaacggacag       720
     cccctcagta acactgagct gcggcacgcc atcgaagaac gagcagacgt cacagaaggc       780
     caagcgcacc ggatcacaga gatcatcgca gcgtggctca agcacttcgg ctcgtactac       840
     accgaggtcg gatcgtggga actccgccac ggccgcgaac tgggctga                    888
//

If you have problems or comments...

PBIL Back to PBIL home page