(data stored in ACNUC7421 zone)

EMBL: CP001630.PE59

CP001630.PE59        Location/Qualifiers
FT   CDS_pept        complement(69961..70266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34033.1"
FT                   /translation="MNLHPRVGLPTRGWGDRSGYRHPFGKIAHVTFSHESDQSKPNYDQ
FT                   PTIRIAPVAPIVPVVPAAGPGTVPPAQRQQAQPVARKSKLRRIARRIVGPTILTKR"
     atgaaccttc acccccgtgt gggcttgccc acacgggggt ggggtgaccg ttcgggttat        60
     cggcacccgt ttggcaagat cgcgcacgtg acgttcagcc atgagtctga ccagtccaag       120
     ccgaactacg accagccgac gatccgcatc gcgccggtcg ccccgatcgt cccggtcgtt       180
     ccggccgccg ggccggggac cgtccccccg gcgcagcgcc agcaagccca accggtcgcc       240
     cggaagagca agctgcgccg gatcgcccgc cggatcgtgg ggccgaccat cctgaccaag       300
     aggtag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page