(data stored in ACNUC7421 zone)

EMBL: CP001630.PE6

CP001630.PE6         Location/Qualifiers
FT   CDS_pept        6701..8674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33980"
FT                   /db_xref="GOA:C6WCF9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF9"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU33980.1"
FT                   /translation="MAAQKKDYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIQEV
FT                   VDNSVDEAMAGYASKVVVTLLANGGVRVVDDGRGIPVDLHPVEGKPTLEVVLTKLHAGG
FT                   KFDSDSYAVSGGLHGVGISVVNALSTAVDVEVKRQGFTWNQRFEASKPAHELQRGVPTS
FT                   ETGTTITFWADPTIFETTDYNIETISRRLQEMAFLNKGLSIVLRDERVAEEGAEEADAE
FT                   GHVAKVRERVFHYPGGLEDFVRHLNHTREAVHQKVVSFEAKGDDLEVEVAMQWNTGYTP
FT                   SVYTFANTINTHEGGTHEEGFRAALTRVVNEYARDKKLIKEKDANLTGDDIREGLAAII
FT                   SVKLKEPQFEGQTKTKLGNSEAKSFVQKSTNEHLADWFERHPNEAKTIITKAVSSSQAR
FT                   IAARKARELVRRKGALDIGGLPGKLKDCRSSNPEECEVYIVEGDSAGGSAKEGRDSMYQ
FT                   AILPIRGKIINVEKARIDRVLKNTEVQSIITAMGTGIHDEFDVSKLRYHKVVLMADADV
FT                   DGQHIRTLLLTLLFRFMRPLLEHGHVYLAQPPLYKIKWLRAEPEYAYSDRERDGLIEQG
FT                   LAAGKKIGKDDNIQRYKGLGEMNAEELWETTMDPANRVLLQVTMDDAAAADELFSVLMG
FT                   EDVEARRSFITRNAKGVRFLDV"
     gtggcagccc agaagaagga ttacggcgcg tcgtcgatca ccgtgctgga agggctggaa        60
     gcggtccgca agcgccccgg catgtacatc ggctccaccg gggagcgcgg tctgcaccac       120
     ctgatccagg aggtcgtgga caactccgtc gacgaggcga tggcgggcta cgcctccaag       180
     gtcgtggtga cgctgctggc gaacggtggt gtccgggtcg tcgacgacgg ccgcggcatc       240
     ccggtcgacc tccacccggt ggagggcaag ccgaccctgg aggtcgtgct caccaagctg       300
     cacgcgggcg gcaagttcga cagcgactcc tacgcggtgt ccggcggcct gcacggcgtc       360
     ggcatctccg tggtgaacgc gctgtccacc gcagtcgacg tcgaggtcaa gcgccagggt       420
     ttcacgtgga accagcgctt cgaggccagc aagcccgcgc acgagctgca gcggggcgtc       480
     ccgacgtccg agaccggcac cacgatcacg ttctgggccg acccgacgat cttcgagacc       540
     accgactaca acatcgagac catctcgcgc aggctccagg agatggcctt cctcaacaag       600
     gggctcagca tcgtcctgcg ggacgagcgg gtcgcggagg agggcgccga ggaggccgac       660
     gccgagggcc acgtggccaa ggtccgcgag cgggtcttcc actaccccgg cggcctggag       720
     gacttcgtcc gccacctcaa ccacacgcgc gaggccgtcc accagaaggt ggtcagcttc       780
     gaggccaagg gcgacgacct cgaggtcgag gtcgcgatgc agtggaacac cggctacacg       840
     ccgtcggtgt acaccttcgc caacacgatc aacacgcacg agggcggcac ccacgaggag       900
     ggcttccgcg ccgcgctgac ccgagtggtc aacgagtacg cgcgcgacaa gaagctcatc       960
     aaggagaagg acgccaacct caccggcgac gacatccgcg agggcctcgc cgcgatcatc      1020
     tcggtgaagc tcaaggagcc ccagttcgag ggccagacga agaccaagct gggcaacagc      1080
     gaggccaagt cgttcgtgca gaagtccacg aacgagcacc tggcggactg gttcgagcgc      1140
     caccccaacg aggcgaagac catcatcacc aaggcggtct cgtcctcgca ggcccgcatc      1200
     gccgcccgca aggcgcgcga gctggtgcgc cgcaagggcg ccctggacat cggcggcctg      1260
     cccggcaagc tcaaggactg ccgctcctcc aacccggagg agtgcgaggt ctacatcgtg      1320
     gagggcgact ccgcgggcgg ctcggccaag gagggccggg actccatgta ccaggcgatc      1380
     ctgccgatcc ggggcaagat catcaacgtg gagaaggccc gcatcgaccg ggtgctcaag      1440
     aacaccgagg tccagtcgat catcacggcg atgggcaccg gcatccacga cgagttcgac      1500
     gtcagcaagc tgcgctacca caaggtcgtg ctgatggcgg acgccgacgt cgacggccag      1560
     cacatccgca ccctgctgct caccctgctg ttccgcttca tgcggccact gctggagcac      1620
     gggcacgtgt acctcgcgca gccgccgctg tacaagatca agtggctgcg ggccgagccg      1680
     gagtacgcct acagcgaccg cgagcgcgac ggcctgatcg agcagggcct cgccgcgggc      1740
     aagaagatcg gcaaggacga caacatccag cgctacaagg gcctgggcga gatgaacgcc      1800
     gaggagctgt gggagaccac gatggacccg gccaaccggg tgctgctcca ggtgacgatg      1860
     gacgacgccg ccgcggccga cgagctgttc agcgtgctga tgggcgagga cgtggaagcc      1920
     cgccggtcct tcatcacccg caacgccaag ggcgtccgct tcctcgacgt gtga            1974
//

If you have problems or comments...

PBIL Back to PBIL home page