(data stored in ACNUC7421 zone)

EMBL: CP001630.PE60

CP001630.PE60        Location/Qualifiers
FT   CDS_pept        complement(70271..70696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0060"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mlo:mlr4254
FT                   osmotically inducible protein C, putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34034"
FT                   /db_xref="GOA:C6WDN9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN9"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34034.1"
FT                   /translation="MATVRKATTHWKGSLMEGDGTVTLESSGVGTYDVSWPSRAEQANG
FT                   KTSPEELIAAAHSSCYSMALSHGLAQAGTPPQQVDTSAEVTFKPGTGITGIHLTVRAVV
FT                   PGLEADAFAEAAETAKKNCPVSQALAAVEITLDAALA"
     atggcgaccg ttcgcaaggc caccacccac tggaagggca gcctgatgga gggtgacggc        60
     accgtcaccc tggagtcctc cggcgtcggc acctacgacg tgagctggcc gtcgcgggcc       120
     gagcaggcca atggcaagac cagcccggaa gagctgatcg ccgcagccca ctcctcgtgc       180
     tactcgatgg cgctgtccca cggcctcgcc caggcgggca ccccgccgca gcaggtggac       240
     acctccgccg aggtcacgtt caagccgggc acgggcatca ccggcatcca cctgaccgtg       300
     cgcgcggtcg tccccggcct tgaggcggac gcgttcgccg aggcggccga gaccgcgaag       360
     aagaactgcc cggtgagcca ggcgctcgcg gcggtcgaga tcaccctcga cgccgctctc       420
     gcctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page