(data stored in ACNUC7421 zone)

EMBL: CP001630.PE61

CP001630.PE61        Location/Qualifiers
FT   CDS_pept        complement(70942..71337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34035.1"
FT                   /translation="MADWRTRAASLLPELTAVVERESWSCHVFLTELWQLALDGHREDD
FT                   RDLLTRVYGFAHWCFRQEQFLANAAVVSFYEHVFDEWELRDAVAPWLPTEVVDKVRPLW
FT                   EWRWPQERLSEVDRLLSGSGTPGERAV"
     gtggccgact ggagaacgag agccgcgtca ctcctgccgg agctgaccgc ggtggtcgag        60
     cgcgagtcgt ggtcctgcca cgtgttcctg accgagctgt ggcagctggc gctcgacggg       120
     caccgcgagg acgaccgcga cctgctgacc agggtctacg ggttcgccca ctggtgcttc       180
     cgccaggagc agttcctggc gaacgcggcg gtggtcagct tctacgagca cgtgttcgac       240
     gagtgggagc tcagggacgc ggtcgcgccc tggctgccga ccgaggtcgt ggacaaggtt       300
     cggccgctgt gggagtggcg gtggccgcag gagcggttgt ccgaggtaga ccggttgctg       360
     agcggttcgg gcacccccgg tgaacgagcg gtttga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page