(data stored in ACNUC7421 zone)

EMBL: CP001630.PE62

CP001630.PE62        Location/Qualifiers
FT   CDS_pept        71534..73003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0062"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   afw:Anae109_0839 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34036"
FT                   /db_xref="GOA:C6WDP1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34036.1"
FT                   /translation="MAIGARLGLEVPGGMADEADVDLELLARVRAGDDAAFGELYSRHA
FT                   DAVRRFALRHVREHAEADDLAAEAFFRVLQAIRRGSGPTEHVRTYLLTTARRVAWEWSG
FT                   RRRDVPVEDEELSRRVEPFPDATAGRAEHTLISRAFTSLPERWRSVLWQVEVEGVRPSA
FT                   VAPAFGLSPNAMAALARRAREGLRAAYLQAHLADDRGPRACHSVVAKLGAYTAGGVQGA
FT                   EQARIRKHLRTCSSCNALHAELAEVCSALRAHAGLLAAPALLSLAFAPEVVAPVAGKVK
FT                   LALTAASVAAVGVFGVAAGALDGGPGPALVQPGPYALRTTVDDPLTPRPSVTLTGTATS
FT                   LPPAGDGAARPATSNRPSGGGGRGSLTGGDRVGPPTGAPPQSGGPQSGEPPTGGPPFGE
FT                   PASGEPGSGQSEPPATTSPTPGALEDPGTTALSTPDDPEQSGKEDPEPPGTTTTGQGPD
FT                   PEPGPSVLQSPELGITPTTVTLHPRTAYPVG"
     ttggcgatcg gagcgcgact cgggctggag gtgccgggcg ggatggccga cgaagccgat        60
     gtcgacctgg aactgctcgc gagggtccgc gccggggacg acgccgcgtt cggcgagctg       120
     tactcccggc acgcggacgc cgtccgcagg ttcgccctcc gccacgtccg cgagcacgcc       180
     gaggccgacg acctcgccgc cgaggcgttc ttccgggtgc tccaggccat ccgccggggc       240
     agcggcccca ccgagcacgt gcgcacctac ctgctgacca ccgcgcgccg ggtcgcctgg       300
     gagtggagcg ggcgcaggcg cgacgtgccg gtggaggacg aggagctgag caggcgggtc       360
     gagccgttcc ccgacgccac cgcgggccgg gccgagcaca ccctgatctc gcgggcgttc       420
     accagcctgc cggagcggtg gcgcagcgtg ctgtggcagg tcgaggtgga gggcgtgcgg       480
     ccgtccgccg tggcgcccgc gttcgggctc agccccaacg cgatggcggc gctggccagg       540
     cgcgcccgtg aggggttgcg ggccgcgtac ctccaggcgc acctggccga cgaccggggg       600
     ccgcgcgcgt gccactcggt ggtggccaag ctgggcgcgt acacggcggg cggggtgcag       660
     ggcgcggagc aggcgcgcat ccgcaagcac ctgcggacct gctcgtcctg caacgcgctg       720
     cacgccgagc tggccgaggt ctgctcggcg ctgcgcgccc acgctggcct gctcgccgcg       780
     cccgcgctgc tgtcgctggc gttcgcaccg gaggtcgtag ccccggtggc gggcaaggtg       840
     aagctggcgc tgaccgcggc ctcggtggcg gcggtcgggg tgttcggcgt ggcggcgggc       900
     gcgctcgacg gcggtccggg gcccgcgctg gtgcagccgg ggccgtacgc gctgcgcacc       960
     acggtggacg acccgctgac gccccgcccg agcgtgacgc tgaccgggac ggccaccagc      1020
     ctcccgcctg ccggcgacgg ggccgcgcgc cccgcgacct cgaaccggcc gtcgggcggc      1080
     ggggggcggg ggtcgctcac cggcggtgac cgggtcgggc cgccgaccgg cgcgcccccg      1140
     cagtccgggg ggccgcagtc cggcgagccg ccgaccgggg ggccgccctt tggcgagccc      1200
     gcgtccggcg agccgggttc cgggcagtcc gagccgcctg ccaccacgag cccgaccccc      1260
     ggcgcgctgg aggaccccgg caccaccgcg ctgagcacgc cggacgaccc ggagcagtcg      1320
     ggcaaggagg accccgagcc gcccggcacg accaccaccg gtcaggggcc cgacccggag      1380
     cccggcccgt cggtgctcca gagccctgag ctgggaatca cgccgaccac ggtcaccctg      1440
     cacccccgga cggcctaccc ggtgggctga                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page