(data stored in ACNUC7421 zone)

EMBL: CP001630.PE63

CP001630.PE63        Location/Qualifiers
FT   CDS_pept        73127..73564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34037"
FT                   /db_xref="GOA:C6WDP2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34037.1"
FT                   /translation="MTRLVRGADGRMWTVRSQVEWRNPAADADFEHDVSGGQGPGVLML
FT                   AIVAAMGVLLVAWTPEQVVVPAWLGLALAMMFLFFPVRWAIRRPHLVVAESKATGDDLP
FT                   PERWVGHVRGVLNVRDEVGNIARKIEMYSLPDIDGPLQPVD"
     atgacgcggc tggtgcgcgg tgcggacggc cggatgtgga cggttcgcag ccaggtcgag        60
     tggcgcaacc ccgccgccga cgccgacttc gagcacgacg tgagcggcgg tcagggtccc       120
     ggcgtgctga tgctcgccat cgtggccgcc atgggcgtgc tgctcgtggc gtggaccccg       180
     gagcaggtcg tcgtcccggc gtggctcggc ctcgcgctgg cgatgatgtt cctgttcttc       240
     ccggtccgct gggcgatccg ccgcccgcac ctggtggtcg ccgagtccaa ggcgaccggc       300
     gacgacctcc cgcccgagcg ctgggtgggc cacgtgcgcg gcgtgctgaa cgtgcgcgac       360
     gaggtcggca acatcgcccg gaagatcgag atgtactcgc tcccggacat cgacggtccg       420
     ctgcagccgg tcgactga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page