(data stored in ACNUC7421 zone)

EMBL: CP001630.PE64

CP001630.PE64        Location/Qualifiers
FT   CDS_pept        73786..75072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0064"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: signal transduction histidine
FT                   kinase, LytS; K07704 two-component system, LytT family,
FT                   sensor histidine kinase LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34038"
FT                   /db_xref="GOA:C6WDP3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU34038.1"
FT                   /translation="MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS
FT                   TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD
FT                   GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL
FT                   IVVSGVPNKRQIRMAEETARFVSTQLELEVLQKSRQALAQAEVRALRAQISPHFVYNAL
FT                   NTISSLIRTDPVYARELLQEFAEFTRYSFRTDGFFTTLSDELTNIHRYLTIEQARYGAR
FT                   LEVRLRIAPEVLQVVLPFLCLQPLVENAVRHGLAKKPGGGMLTITAEDNGAEALISVED
FT                   DGVGMDPERLFEDLKDAHQTGAHVGLGNINHRMRAVFGDDYALVVETAPEAGMKIILKV
FT                   PKYRQGVRPNLTLVAPRVEETGEQAVLRA"
     ttgcctggag cacgccgacc ccacagcatg gacggcgtgc gcgatctcct gaccgagcgg        60
     gcggtgctcg gcgtcatcgc caccctggcc gtcctggggc tgttcgtgat gctctgccgg       120
     gcgcgcaggg tgagcacctc ggtcgaggac gccgtgatgg acatgctcca ccgcatgtcg       180
     aaggcgtcgg ccgacctgcg ggagggcctg acggcggagg cggccgacaa ggccaccccg       240
     cacctgcggg agatgctgcg ctgcgtcgcg gtcggcatca ccgacagcac cggcagcgtg       300
     ctgtcctggg acggcggcgc ggccgaccac tacgagctga tgcgcgggca catagagcag       360
     gcgatccgcg aggtgcacaa ggagcacgtc gagcaccgca agctcgactg cgacctgtcc       420
     gggccgtgcc ccatgcacag cgcggtgatc gtgccgctga tcgtggagtc cgaggtcgcg       480
     ggcacgctga tcgtggtcag cggggtgccg aacaagcggc agatccggat ggcggaggag       540
     accgcgcggt tcgtctccac gcagctggag ctggaggtgc tgcagaagtc ccggcaggcg       600
     ctggcgcagg ccgaggtcag ggcgctgcgg gcgcagatct cgccgcactt cgtctacaac       660
     gcgctcaaca ccatctcgtc gctgatccgc accgacccgg tgtacgcgcg ggagctgctg       720
     caggagttcg cggagttcac ccgctactcg ttccgcaccg acgggttctt cacgacgctg       780
     tcggacgagc tgaccaacat ccaccggtac ctgaccatcg agcaggcccg gtacggggcg       840
     cggctggagg tgcggctgcg catcgcgccc gaggtgctcc aggtcgtgct gccgttcctg       900
     tgcctgcaac cgctggtgga gaacgcggtc cggcacgggc tggccaagaa gcccggcggc       960
     gggatgctca cgatcaccgc cgaggacaac ggggccgagg cgctgatcag cgtcgaggac      1020
     gacggcgtcg gcatggaccc ggagcggttg ttcgaggacc tgaaggacgc gcaccagacc      1080
     ggggcgcacg tcgggctggg caacatcaac caccggatgc gggcggtgtt cggcgacgac      1140
     tacgcgctgg tcgtggagac cgcgcccgag gccgggatga agatcatcct caaggtcccc      1200
     aagtaccggc agggcgtccg gcccaacctg accctggtgg ccccgcgcgt ggaggagacc      1260
     ggcgagcagg ccgtgctgcg cgcgtga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page