(data stored in ACNUC7421 zone)

EMBL: CP001630.PE65

CP001630.PE65        Location/Qualifiers
FT   CDS_pept        complement(75077..75244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34039"
FT                   /db_xref="GOA:C6WDP4"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34039.1"
FT                   /translation="MTFNPIRWLERYVEWWDERGRKNADGPSAMHVYWMWITWAVCGVM
FT                   LVTALAVAAR"
     gtgacgttca acccgatccg ctggctggag cgctacgtcg agtggtggga cgagcggggc        60
     cggaagaacg ccgacggccc cagcgcgatg cacgtctact ggatgtggat cacctgggcg       120
     gtgtgcgggg tcatgctggt gaccgcgctg gccgtcgccg cgcgctag                    168
//

If you have problems or comments...

PBIL Back to PBIL home page