(data stored in ACNUC7421 zone)

EMBL: CP001630.PE66

CP001630.PE66        Location/Qualifiers
FT   CDS_pept        75285..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0066"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rce:RC1_1672 proteinase
FT                   SohB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34040"
FT                   /db_xref="GOA:C6WDP5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACU34040.1"
FT                   /translation="MSVTDKIASRLPKIVGDRVDRGPVVAAVRLHGVITPNPGPVAARG
FT                   SLNAQSVESALTRAFEHERLVAVALLVNSPGGAPTQSALIADRVRELAAKRRVPVLAFC
FT                   EDVAASGGYWLACAADEIHAHPTSLVGSIGVVSSGFGLTGLMERFGVERRVHSAGESKV
FT                   RLDPFQPEKAEDVAWLEGLQSELHEQFKAWVTERRGRRLAADAPDLFAGEVWTGAKALE
FT                   LGLVDGLGTLRGVIGKRYPDAEIAIAEPRRNLLSRLGLGNAASTRSGDFVTQALASLEE
FT                   RARWSRFGL"
     atgagcgtga ccgacaagat cgcctcgcgg ctcccgaaga tcgtcggcga ccgggtcgac        60
     cgcggcccgg tcgtcgccgc ggtccggctg cacggggtca tcaccccgaa ccccggaccg       120
     gtcgccgcgc gcggcagcct gaacgcccag tccgtcgagt ccgcgctgac ccgcgccttc       180
     gagcacgagc gcctggtcgc cgtggcgctg ctggtgaact cgcccggcgg cgccccgacc       240
     cagtccgcgc tgatcgccga ccgcgtccgc gagctggccg cgaagcgccg ggtgcccgtg       300
     ctggcgttct gcgaggacgt cgcggcctcc ggcggctact ggctggcctg cgccgccgac       360
     gagatccacg cgcaccccac ctcgctggtc ggctccatcg gcgtcgtcag ctccgggttc       420
     ggcctcaccg ggctgatgga gcgcttcggc gtcgagcgcc gggtgcacag cgcgggcgag       480
     agcaaggtgc ggctcgaccc gttccagccg gagaaggccg aggacgtggc ctggctggaa       540
     ggtctccagt ccgagctgca cgagcagttc aaggcgtggg tcaccgagcg cagggggcgc       600
     aggctggccg ccgacgcgcc cgacctgttc gccggcgagg tctggaccgg ggccaaggcg       660
     ctggagctgg ggctggtcga cgggctgggc acgctgcgcg gcgtcatcgg caagcgctac       720
     cccgacgccg agatcgccat cgccgagccc cgcaggaacc tgctcagcag gctcggcctc       780
     ggcaacgcgg cgtccacacg atcgggtgac ttcgtgacgc aggcgctggc gagcctggag       840
     gagcgcgcgc gctggtcccg attcggcttg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page