(data stored in ACNUC7421 zone)

EMBL: CP001630.PE67

CP001630.PE67        Location/Qualifiers
FT   CDS_pept        76254..77081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0067"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding region; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gur:Gura_2791 LytTR family two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34041"
FT                   /db_xref="GOA:C6WDP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP6"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ACU34041.1"
FT                   /translation="MSSGLLVLAVDDEAPGLDEIKFLLESSPHIRRVLTAFDAAEALRI
FT                   LRGDYDTEVMERQEAGQPPVDAVFADINMPGLSGTDLARVLGAFRAPPALVFVTGVEHS
FT                   EAVVAFDVGAVDFVTKPINSDRVNKAIARVVDRVNSVSAAAAAPEPTAADSQDDEVIPV
FT                   ELGGTIKLVPRASVRYVEAQGDYARLHTNDGQSHLVRIPLAQLEERWENAGFVRIHRSF
FT                   LVALPLVTELRMTSNGYAVVIGSGEGAKELPVSRRHTRDLKERIVRPPKSNWG"
     atgagctccg gcctcctcgt cctggcggtg gacgacgagg cgccaggtct ggacgagatc        60
     aagttcctgc tggagagcag cccgcacatc cgccgcgtgc tgaccgcgtt cgacgcggcg       120
     gaggcgctgc gcatcctcag gggcgactac gacaccgagg tgatggagcg ccaggaggcg       180
     ggccagcccc cggtggacgc ggtgttcgcc gacatcaaca tgcccggtct gagcggcacc       240
     gacctggccc gcgtgctcgg cgccttccgc gcgccgcccg cgctggtgtt cgtcaccggc       300
     gtcgagcact ccgaggccgt ggtggcgttc gacgtcggcg cggtcgactt cgtgaccaag       360
     ccgatcaaca gcgaccgggt caacaaggcc atcgcgcgcg tggtcgaccg ggtcaactcg       420
     gtgtcggccg ccgccgccgc gccggagccg accgccgccg actcccagga cgacgaggtc       480
     atcccggtcg agctcggtgg aacgatcaag ctcgtgccga gggccagcgt ccgctacgtg       540
     gaggcccagg gcgactacgc tcggctgcac accaacgacg gccagagcca cctcgtgcgc       600
     atcccgctgg cccagctgga ggagcgctgg gagaacgcgg ggttcgtgcg catccaccgc       660
     tccttcctgg tcgcgctgcc gctggtgacc gagctgcgga tgacgtccaa cggctacgcg       720
     gtggtcatcg gcagcggcga gggggcgaag gagctgccgg tgagccgcag gcacaccagg       780
     gacctgaagg agcggatcgt gcgcccgccg aagagcaact ggggatga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page