(data stored in ACNUC7421 zone)

EMBL: CP001630.PE68

CP001630.PE68        Location/Qualifiers
FT   CDS_pept        77078..77500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34042"
FT                   /db_xref="GOA:C6WDP7"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34042.1"
FT                   /translation="MSEQPGPPAEQPAPGEHAPAQGRKPRRRRVVLADPKGRGRVLRTI
FT                   IELEEQTSVGEKLVRDLIRQQLRTAFVLGGGTLLAVALLPLLFYLVDLSEVQLFGVRLP
FT                   WLLLGLVPFPLFYLVGLLSRRQAERHERDFVSMVDR"
     atgagcgagc agcccggacc gcccgcggag cagcccgcgc ccggcgagca cgcgcccgcg        60
     cagggccgca agccccggcg caggcgcgtc gtgctggccg accccaaggg ccggggccgg       120
     gtgctgcgca cgatcatcga gctggaggag cagaccagcg tcggcgagaa gctggtccgc       180
     gacctgatca ggcagcagct gcgcaccgcg ttcgtgctcg gcggcgggac gctgctggcc       240
     gtcgcgctgc tgccgctgct gttctacctg gtcgacctgt ccgaggtgca gctgttcggg       300
     gtgcgcctgc cgtggctgct gctcgggctg gtgccgttcc cgctgttcta cctggtcggg       360
     ctgctcagcc gcaggcaggc cgagcggcac gagcgcgact tcgtcagcat ggtcgaccgc       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page