(data stored in ACNUC7421 zone)

EMBL: CP001630.PE69

CP001630.PE69        Location/Qualifiers
FT   CDS_pept        77504..79315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0069"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: dac:Daci_5957 SSS
FT                   family solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34043"
FT                   /db_xref="GOA:C6WDP8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP8"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACU34043.1"
FT                   /translation="MVQNLWSLSLVAVVAVVTFLLGYVGSRRANTTPDFLVARRAVPAT
FT                   RNAAAISGEYLSAASFLGVAGLILKDGVDALWYPIGFTAGYLAMMLFVAAPLRRSGAYT
FT                   LPDFAEARLGSRKLRHFCTFFVVCIGVLYLVPQLQSAGLTLNTITGLPAWLGGVLVTLI
FT                   VVANVLGGGMRAITLVQAFQYWGKLFAISAPTFVLFAVFLTGPGTSAQSVDAEGVLLFH
FT                   EPVTVTTVDPVRLEVTSLTKLHVVGEVDGARADGPAYWGPDSGGAPKTYSVAKGTELRF
FT                   TAGSPVPVVEGAPSANDVWLRPQTDGLGGLFETYSLIFATFLGTMGLPHVLVRFYTNPD
FT                   GKAARRTALHVLYLLGLFYVFPTVLGVISRLYLPQLLVTGKTDAAVLLLPHTMLPGVLG
FT                   QILGAVVAAGAFAAFLSTSSGLVVSVAGVVSTDILRGKVRDFRWATVLTGAVAIGLALL
FT                   LPRSDASLTVAMSFALAASTFCPLLLLGIWWRGLTWVGAVAGLVVGGGLVILSQVVTAV
FT                   SKATGDWAPALLAQPALVTVPIAFLTMIWISKLTGPSRPADVNQVLLRLHAPDRLGFMR
FT                   DRGARFASGGARRAGEGQHRGAAGSGG"
     atggtgcaga acctgtggag cctgagcctg gtcgccgtgg tcgcggtggt cacgttcctg        60
     ctgggctacg tgggttcccg ccgggccaac acgaccccgg acttcctggt cgcccggcgc       120
     gcggtgcccg ccacccgcaa cgcggcggcg atctccggcg agtacctctc ggcggcctcg       180
     ttcctcggcg tcgccgggct gatcctcaag gacggcgtcg acgcgctctg gtacccgatc       240
     ggcttcaccg cgggctacct ggcgatgatg ctgttcgtcg ccgcgccgct gcgccgctcg       300
     ggcgcgtaca ccctgcccga cttcgccgag gcgcggctcg ggtcgcgcaa gctccggcac       360
     ttctgcacgt tcttcgtggt gtgcatcggg gtgctgtacc tggtgccgca gctgcagagc       420
     gccgggctga ccctgaacac gatcaccggg ctgcccgcgt ggctgggcgg cgtgctggtg       480
     acgctgatcg tggtggcgaa cgtgctcggc ggcgggatgc gggcgatcac gctggtccag       540
     gcgttccagt actggggcaa gctgttcgcc atctcggcgc cgacgttcgt gctgttcgcg       600
     gtgttcctga ccgggccggg caccagcgcg cagtccgtgg acgccgaggg cgtgctgctg       660
     ttccacgagc cggtcaccgt gaccaccgtc gacccggtgc ggctggaggt gacctcgctg       720
     accaagctgc acgtggtcgg cgaggtggac ggggcgcgcg cggacgggcc cgcgtactgg       780
     gggccggact cgggtggcgc gccgaagacg tactcggtgg ccaagggcac cgagctgcgg       840
     ttcacggcgg gctcgccggt gccggtggtg gagggagcgc cgagcgcgaa cgacgtgtgg       900
     ctgcgcccgc agaccgacgg gctgggcggg ctgttcgaga cctactcgct gatcttcgcg       960
     acgttcctgg gcacgatggg gctgccgcac gtgctggtgc ggttctacac gaacccggac      1020
     ggcaaggcgg cgcggcgcac ggcgctgcac gtgctctacc tgctggggct gttctacgtc      1080
     ttcccgaccg tgctcggggt gatctcccgg ctgtacctgc cgcagctgct ggtgaccggc      1140
     aagaccgacg cggcggtgct gctgctgccg cacacgatgc tgccgggggt gctcgggcag      1200
     atcctcgggg cggtggtggc ggcgggcgcg ttcgcggcgt tcctgtccac ctcgtccggg      1260
     ctggtggtga gcgtcgccgg ggtggtgtcc acggacatcc tgcgcggcaa ggtgcgggac      1320
     ttccggtggg cgacggtgct gaccggcgcg gtcgcgatcg ggctcgcgct gctgctgccg      1380
     cgcagcgacg cctcgctgac cgtggcgatg tcgttcgcgc tggccgcgtc gacgttctgc      1440
     ccgctgctgc tgctggggat ctggtggcgg gggctgacct gggtcggggc ggtggccggg      1500
     ctggtcgtcg gcggcggact ggtgatcctg tcgcaggtgg tgacggcggt gagcaaggcg      1560
     acgggggact gggcgcccgc gctgctggcg cagcccgcgc tggtgacggt gccgatcgcg      1620
     ttcctgacca tgatctggat cagcaagctg accgggccga gcaggcccgc ggacgtgaac      1680
     caggtgctgc tgcggctgca cgcgcccgac cggctggggt tcatgcgcga ccggggggcg      1740
     cggttcgcgt ccgggggcgc gcgcagggcg ggcgaggggc agcaccgggg cgcggcgggg      1800
     tcggggggct ga                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page