(data stored in ACNUC7421 zone)

EMBL: CP001630.PE7

CP001630.PE7         Location/Qualifiers
FT   CDS_pept        8721..11243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sus:Acid_3975 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33981"
FT                   /db_xref="GOA:C6WCG0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG0"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU33981.1"
FT                   /translation="MSETTLPPIGGGSDRTEPRDLQQEMQNSYIDYAMSVIVGRALPDV
FT                   RDGLKPVHVRVLYSMFDSRFLPERSYNKCARVVGDVMGNYHPHGDSAIYDALVRLAQPW
FT                   AMRYPLIDGQGNFGSQGNDPAAAMRYTECRLTPLAMRMLADIEEDTVDFRDNYDGRIQE
FT                   PTVLPSRVPNLLINGSSGIAVGMATNIPPHNLREVAEGVVWALDNPEASDEETLEAMIA
FT                   RIKGPDFPTYGQILGTQGIEDAYRTGRGSVKMRAVVEMDEDAKGRTILVVSELPYQVNP
FT                   DNLVENIASLVRDQKINGISNIADESNRRSGMRIVVTVKRDAVAKVVLNNLYKHTQLQY
FT                   SFGVNMLSLVDGVPRTLRLDQMIRHYVKHQIEVIVRRTKFRLRKAEERAHVWRGLVKAL
FT                   DQLDAVIALIRRSDTTESARSGLMELLSVDEVQSNAILEMQLRRLAALERQKIIDQLAE
FT                   IELQIADLKDILAKPERQRAIVRGELLEIVDKHGDDRRTKIVPFDGDVSMEDLIAVEDV
FT                   VVTITRTGYAKRTKTDLYRAQKRGGKGVQGAQLKQDDIVQHFFVCSTHDWILFFTNKGR
FT                   VYRTKAYDLPEASRNARGQHVANLLAFQPDEEIAQVIQIKNYEAAPYLVLATRNGLVKK
FT                   SKLSDFDSNRSGGLIGINLREEDELVGAVLTGEGDDLLLVSKDGQSIRFHSSDDVLRPM
FT                   GRATSGVQGMRFNSDDELLSMGVVQEGLFVLVATDGGYAKRTPIEDYPVQGRGGKGVLT
FT                   IQHDRRRGRLVGALIVDVEDELYAITSAGGVIRTSAKEIRKAGRQTKGVRLMNLGEKST
FT                   LIAVARNADEPADVSTGEEDDQAIEPAN"
     gtgagcgaga cgaccctgcc cccgatcggc ggcggaagcg accgcaccga gccgcgcgac        60
     ctccagcagg agatgcagaa ctcgtacatc gactacgcga tgagcgtgat cgtgggacgg       120
     gcgctgccgg acgtgcgcga cggcctcaag ccggtccacg tgcgcgtgct gtactcgatg       180
     ttcgactccc gcttcctgcc cgagcgcagc tacaacaagt gcgcccgcgt cgtcggcgac       240
     gtgatgggca actaccaccc gcacggcgac tcggcgatct acgacgccct cgtgcgcctg       300
     gcccagccgt gggcgatgcg gtacccgctc atcgacggcc agggcaactt cggttcccag       360
     ggcaacgacc cggcggcggc catgcggtac accgagtgcc gcctcacgcc gctggccatg       420
     cggatgctcg cggacatcga ggaagacacc gtcgacttcc gcgacaacta cgacggccgc       480
     atccaggagc cgaccgtcct gccgtcgcgg gtgccgaacc tgctcatcaa cggctcgtcc       540
     ggcatcgcgg tcggcatggc caccaacatc ccgccgcaca acctccgcga ggtcgcggag       600
     ggcgtggtgt gggcgctgga caacccggag gcctccgacg aggagaccct ggaggccatg       660
     atcgcccgca tcaagggccc ggacttcccg acctacgggc agatcctcgg cacccagggc       720
     atcgaggacg cctaccgcac cggtcgcggc tcggtgaaga tgcgcgcggt cgtcgagatg       780
     gacgaggacg ccaaggggcg caccatcctc gtcgtgtccg agctgcccta ccaggtcaac       840
     ccggacaacc tggtcgagaa catcgcgtcg ctggtgcgcg accagaagat caacggcatc       900
     tcgaacatcg ccgacgagtc caaccgccgc tccgggatgc gcatcgtcgt cacggtcaag       960
     cgcgacgccg tggcgaaggt ggtgctgaac aacctctaca agcacaccca gctgcagtac      1020
     tcgttcggcg tgaacatgct gtcgctggtg gacggggtgc cccgcacgct gcgcctggac      1080
     cagatgatcc ggcactacgt gaagcaccag atcgaggtca tcgtccggcg caccaagttc      1140
     cggctgcgca aggcggagga gcgggcccac gtctggcgcg gcctggtcaa ggcgctcgac      1200
     cagctcgacg cggtcatcgc gctgatccgc cggtcggaca cgaccgagtc ggcgcgctcg      1260
     ggcctgatgg agctgctgtc cgtcgacgag gtccagtcca acgcgatcct ggagatgcag      1320
     ctccgccgcc tggcggccct ggagcgccag aagatcatcg accagctggc cgagatcgag      1380
     ctccagatcg cggacctcaa ggacatcctg gccaagccgg agcggcagcg cgccatcgtg      1440
     cgcggggagc tgctggagat cgtcgacaag cacggcgacg accggcgcac caagatcgtc      1500
     ccgttcgacg gcgacgtgtc catggaggac ctgatcgcgg tcgaggacgt ggtcgtcacg      1560
     atcaccagga ccggctacgc caagcgcacc aagaccgacc tgtaccgcgc ccagaagcgc      1620
     ggcggcaagg gcgtgcaggg cgcgcagctc aagcaggacg acatcgtgca gcacttcttc      1680
     gtgtgctcca cgcacgactg gatcctgttc ttcaccaaca agggccgggt gtaccgcacc      1740
     aaggcctacg acctgcccga ggccagccgc aacgcgcgcg gccagcacgt ggcgaacctc      1800
     ctcgcgttcc agccggacga ggagatcgcc caggtcatcc agatcaagaa ctacgaggcc      1860
     gcgccgtacc tggtgctggc cacccgcaac ggcctggtga agaagtccaa gctgtcggac      1920
     ttcgactcca accgctccgg cggcctgatc ggcatcaacc tccgcgagga ggacgagctg      1980
     gtcggcgcgg tgctcaccgg cgagggcgac gacctgctgc tggtgtccaa ggacggccag      2040
     tccatccggt tccactccag cgacgacgtc ctgcgcccga tgggccgcgc gacctccggc      2100
     gtccagggga tgcgcttcaa cagcgacgac gagctgctgt cgatgggcgt ggtgcaggaa      2160
     gggctcttcg ttttggtcgc caccgacggt gggtatgcca agcgcacccc gatcgaggac      2220
     tacccggtgc aggggcgggg cggcaagggc gtgctgacga tccagcacga ccgcaggcgt      2280
     gggaggcttg tgggagctct catcgtcgac gtcgaggacg agctgtacgc gatcacctcc      2340
     gcgggcgggg tcatcaggac cagcgccaag gagatccgca aagcgggtag gcagaccaag      2400
     ggcgttcgct tgatgaacct cggggagaag tcgaccttga tcgcggtcgc gcgcaacgcg      2460
     gacgagcccg ccgacgtctc caccggtgaa gaggatgatc aggcgatcga gcctgccaac      2520
     tga                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page