(data stored in ACNUC7421 zone)

EMBL: CP001630.PE70

CP001630.PE70        Location/Qualifiers
FT   CDS_pept        79609..79965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0070"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   gme:Gmet_3287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34044"
FT                   /db_xref="GOA:C6WDP9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP9"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACU34044.1"
FT                   /translation="MSTTEDSAGPTPGSPDSTDWVAVQSSPEFTELRRRLRTFVFPMAG
FT                   LFLTWYVLYVLLADYAHGFMSTKLVGNINVGLVLGLLQFVSTFAITALYVRHANRNLDP
FT                   TAEKIRHELEGGDA"
     gtgagcacca ccgaggactc cgccgggccc acccccggtt cccccgacag caccgactgg        60
     gtggcggtgc agtccagccc cgagttcacc gagctgcgcc gcaggctgcg gacgttcgtc       120
     ttccccatgg cgggcctgtt cctgacctgg tacgtgctct acgtgctgct ggccgactac       180
     gcgcacgggt tcatgtcgac caagctggtc gggaacatca acgtgggcct ggtgctcggg       240
     ctcctccagt tcgtgtccac gttcgcgatc accgcgctgt acgtgcggca cgcgaaccgg       300
     aacctcgacc cgaccgccga gaagatccgg cacgagctcg aagggggcga cgcgtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page