(data stored in ACNUC7421 zone)

EMBL: CP001630.PE71

CP001630.PE71        Location/Qualifiers
FT   CDS_pept        79962..81548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0071"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bca:BCE_1726
FT                   sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34045"
FT                   /db_xref="GOA:C6WDQ0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ0"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACU34045.1"
FT                   /translation="MNTNAVLNIGIFGLFVAATLVVVIRASRNTKTAADYLAAGRAFTG
FT                   PQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLLVAELLRNTGKY
FT                   TMGDVLSFRMRQRPVRAAAATSTMVVSFFYLLAQMAGAGGLVALLLGITGKGGQAIVIA
FT                   VVGALMIAYVLIGGMKGTTWVQIIKAVLLIVGAGVMTIWVLAKYGFNLSTLLGAAVDNA
FT                   PKAGEKLLGPGLQYGATGTTKLDFLSLGLALVLGTAGLPHILMRFYTVPTAKEARRSVV
FT                   WAIWLIGLFYLFTLVLGYGAAALVGPDKINAAPGKANSAAPLLAEAIGGPLLLGLIAAV
FT                   AFATILAVVAGLTITASASFAHDIYANVIKKGEVEDKDAEVRVARRTAIVIGVVSILGG
FT                   IAANGQNVAFLVALAFAVAASANLPTILYSLFWKRFNTAGALWSIYGGLSVTLVLIVLS
FT                   PAVSGRPTSMFPTMDFDLFPLSNPGIISIPLAFLLGYLGTVLSKERNPAKYAEMEVRAL
FT                   TGTGAEKATSH"
     gtgaacacca acgccgtcct gaacatcggc atcttcgggc tcttcgtcgc ggcgaccctg        60
     gtcgtggtca tccgggccag ccgcaacacc aagaccgcgg cggactacct ggcggcgggc       120
     cgcgcgttca ccggcccgca gaacggcatc gccatcgcgg gcgactacct gtccgccgcg       180
     tcgttcctgg gcatcgcggg cgccatcgcg gtctacgggt acgacggctt cctgtactcc       240
     atcgggttcc tggtggcctg gctggtggcg ctgctgctgg tcgcggagct gctgcgcaac       300
     accggcaagt acacgatggg cgacgtgctg agcttccgga tgcgccagcg cccggtccgc       360
     gcggcggcgg ccacgtcgac catggtcgtg tcgttcttct acctgctggc gcagatggcg       420
     ggcgcgggcg gcctggtggc gctgctgctc ggcatcaccg gcaagggcgg ccaggcgatc       480
     gtgatcgcgg tggtcggcgc gctgatgatc gcgtacgtgc tgatcggcgg catgaagggc       540
     accacctggg tgcagatcat caaggccgtg ctgctgatcg tcggcgcggg cgtgatgacg       600
     atctgggtgc tggcgaagta cgggttcaac ctgtccacgc tgctcggcgc ggcggtcgac       660
     aacgcgccga aggcggggga gaagctgctc gggccgggcc tgcagtacgg ggccaccggc       720
     acgacgaagc tggacttcct ctcgctcggc ctcgcgctgg tgctcggcac cgcgggcctg       780
     ccgcacatcc tgatgcgctt ctacacggtg cccaccgcga aggaagcgcg ccggtccgtg       840
     gtgtgggcga tctggctgat cggcctgttc tacctgttca ccctggtcct gggctacggc       900
     gcggcggccc tggtcggccc cgacaagatc aacgcggcac cgggcaaggc gaactcggcg       960
     gccccgctgc tggccgaggc gatcggcggc ccgctgctgc tgggcctgat cgcggcggtc      1020
     gcgttcgcga cgatcctcgc ggtcgtcgcc gggctgacca tcaccgcgtc ggcgtcgttc      1080
     gcgcacgaca tctacgccaa cgtgatcaag aagggcgagg tggaggacaa ggacgcggag      1140
     gtgagggtgg cgcggcggac ggccatcgtc atcggcgtcg tgtccatcct cggcggcatc      1200
     gcggcgaacg gccagaacgt ggcgttcctg gtggcgctgg cgttcgcggt cgcggcgtcg      1260
     gcgaacctgc cgacgatcct gtactcgctg ttctggaagc gcttcaacac ggcgggcgcc      1320
     ctgtggagca tctacggcgg cctgtcggtg accctggtcc tgatcgtcct gtcgcccgcg      1380
     gtctccggaa ggccgacctc gatgttcccg acgatggact tcgacctgtt ccccctgtcg      1440
     aaccccggca tcatctcgat cccgctggcg ttcctgctgg gctacctggg cacggtcctg      1500
     tcgaaggagc ggaacccggc gaagtacgcc gagatggagg tccgcgcgct gaccggcacg      1560
     ggcgcggaga aggccacctc gcactga                                          1587
//

If you have problems or comments...

PBIL Back to PBIL home page