(data stored in ACNUC7421 zone)

EMBL: CP001630.PE72

CP001630.PE72        Location/Qualifiers
FT   CDS_pept        81691..82116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0072"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: maq:Maqu_3385 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34046"
FT                   /db_xref="GOA:C6WDQ1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ1"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34046.1"
FT                   /translation="MGATERDVLFANEVNQRQAQELIGLLSGRNARFTAESDGGGAARQ
FT                   VPAELSGLIAKLVHAVARGQAVTVTTMPEELTTTAAAQLLGISRPTLMRKVNAGEIPSR
FT                   KVGAHTRLRTEDVLRERRERRQRQLAALDELRDLEEF"
     gtgggtgcga ccgagcggga cgtgctgttc gcgaacgagg tcaaccagcg gcaagcgcag        60
     gagctgatcg ggcttctgtc cggcaggaac gcccggttca ccgcagagtc ggacggcgga       120
     ggcgccgcgc gccaagtgcc cgcagagctc tcggggctca tcgccaagct cgtccacgcc       180
     gtggcgcggg ggcaggcggt caccgtcacc acgatgcccg aggagttgac caccactgct       240
     gctgcccagc tgctcggcat ctcgcgcccc acgttgatgc ggaaggtcaa cgcgggggag       300
     atcccctcgc gcaaggttgg ggcgcacacc cgcctgcgta cggaggatgt gctgagggag       360
     cggcgcgagc gcaggcagcg ccagttggcc gcactcgacg agttgcgcga cctcgaagaa       420
     ttctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page