(data stored in ACNUC7421 zone)

EMBL: CP001630.PE73

CP001630.PE73        Location/Qualifiers
FT   CDS_pept        82184..82774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34047"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34047.1"
FT                   /translation="MKVLADANVLYSRTLLDWFGLLQGSDEQQVYHAYWTEDLLAEALF
FT                   HLRRDKPALDGGQISSIRDKIEKAFEGGRVDDFVIDDSFPGKDVNDRHVHAAAVTCQAD
FT                   IVLTCDEGFHSEQVADLLPYEVHKPDEFFVLVHDIAPEIVWQATLKQTRYWVGRGKRAD
FT                   LFDRLVKAGCPEFAARVQVHQSRLSLPHDTTRP"
     atgaaggttt tagccgatgc gaacgtcctg tactcgcgca ccttgcttga ctggttcggg        60
     ctgctgcagg ggagtgatga acagcaggtt tatcacgcct actggaccga ggacctgctc       120
     gcggaagcgc tcttccacct gcgtcgggac aagcctgctc tggacggtgg gcagatcagc       180
     agcatccggg acaagatcga aaaagctttt gaggggggac gggtcgacga cttcgtcatt       240
     gacgactcgt tccccggcaa ggacgtcaac gatcgacacg tgcacgccgc agccgtgacg       300
     tgccaagcag acatcgtcct gacctgtgac gaaggcttcc actcggagca ggtcgcagat       360
     ctgctgccct acgaggtgca caagcccgat gagttcttcg tgctggtcca cgacatcgcg       420
     cctgagatcg tgtggcaagc gaccttgaag cagacccggt actgggtggg cagagggaag       480
     cgggccgatc tgttcgaccg gctcgtcaaa gcaggctgcc ccgagttcgc cgcccgcgtc       540
     caggtccacc agtcccggct ctccctcccc cacgacacca cccgcccctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page