(data stored in ACNUC7421 zone)

EMBL: CP001630.PE74

CP001630.PE74        Location/Qualifiers
FT   CDS_pept        82815..83162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0074"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rfr:Rfer_3913 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34048"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ3"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU34048.1"
FT                   /translation="MSRVTVPSVEVSDVPAELPEGAVLLDVREVDEWAAGHAPGAVHIP
FT                   MSELAGRLGEVPEADVVYVVCRMGGRSARVTEYLNANGWDAVNVDGGMQTWSTQGRPMV
FT                   GELPDVEPEVI"
     atgtcccgtg tgacggttcc cagcgttgaa gtgtccgacg ttccggccga gctgcctgaa        60
     ggcgccgtgc tgctcgacgt gcgcgaggtc gacgagtggg ccgccgggca cgcgcccggt       120
     gcggtgcaca tccccatgag cgagctcgcc gggcggctcg gggaggtgcc cgaggccgac       180
     gtcgtctacg tcgtctgccg gatgggtggg cggtcggcca gggtcaccga gtacctcaac       240
     gccaacgggt gggacgccgt gaacgtcgac ggcgggatgc agacctggtc cacgcagggc       300
     aggccgatgg tgggcgagct gcccgacgtg gagccggagg tcatctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page