(data stored in ACNUC7421 zone)

EMBL: CP001630.PE75

CP001630.PE75        Location/Qualifiers
FT   CDS_pept        83164..84072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34049"
FT                   /db_xref="GOA:C6WDQ4"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34049.1"
FT                   /translation="MRPLQPMRVDWVATPPPGAYPARRFGGARRPYAGPPSYPVPPRWG
FT                   FPLLAWRWPTSVALDEARPLDRVDQVQRLARTASQALGLAGMTALWAAGSELWRYALLL
FT                   LSRTGALSATTVGVSDAMVVAASAVAGITSAIALVLSFLWVRAARAAAAAASGYAPSRS
FT                   ERELVLGLVVPGVNLVVPGSALAELEHAALRLPVDARPKPSKLLLRWWALWVVSALFFA
FT                   LTVAWSFRSSVQALADGVFLHAVSDLLAAGVALTTAVVVRRLTTLLLPLDPASLRRMRV
FT                   VGVKGAPAPELRAIRASGSPR"
     gtgcgaccgc ttcagccgat gcgggtggac tgggtggcga ccccgccgcc cggcgcctac        60
     cccgcccgcc ggttcggcgg cgcccggcgg ccctacgccg gacccccgtc ctacccggtg       120
     ccgccgcgct ggggcttccc gctgctcgcc tggcgctggc ccacctcggt cgcgctcgac       180
     gaggcccgcc cgctcgaccg cgtcgaccag gtgcagcgcc tcgcccgcac cgcctcccag       240
     gccctcggcc tcgccgggat gaccgcgctg tgggccgcgg gcagcgagct ctggcgctac       300
     gccctgctcc tgctcagccg caccggcgcg ctgtccgcca cgacggtcgg cgtctccgac       360
     gccatggtcg tcgccgcctc ggccgtcgcc gggatcacct cggccatcgc gctcgtcctg       420
     tccttcctgt gggtccgcgc cgcccgcgcc gccgccgctg ccgcctccgg ctacgccccc       480
     tcgcgctccg agcgcgaact ggtgctcggc ctggtcgtcc ccggcgtgaa cctggtcgtc       540
     cccggctcgg cgctcgccga gctggagcac gccgccctcc ggctgcccgt cgacgcccgc       600
     cccaagccct ccaagctgct gctccgctgg tgggcgctgt gggtggtgtc cgcgctgttc       660
     ttcgccctca ccgtcgcctg gtcgttccgg agcagcgtgc aggccctcgc cgacggcgtc       720
     ttcctgcacg cggtctccga cctgctcgcc gcgggcgtcg cgctcaccac cgccgtcgtg       780
     gtccgccgcc tcaccaccct gctcctgccg ctcgaccccg cctcgctgcg ccggatgcgc       840
     gtcgtcggcg tgaagggcgc ccccgcgccc gagctgcgcg cgatcagggc atccggttcc       900
     cccaggtag                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page