(data stored in ACNUC7421 zone)

EMBL: CP001630.PE76

CP001630.PE76        Location/Qualifiers
FT   CDS_pept        84163..85212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0076"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34050"
FT                   /db_xref="GOA:C6WDQ5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34050.1"
FT                   /translation="MRALGAALVVMLLLPGAASAGAGTGAGHGHGHGHGKHGFDLQAHR
FT                   GGIGLTVESTLAAFAKALEVGVTTLELDVQITRDGREVVTHDRRTNPAKCVDTAPARPG
FT                   DPEFPYAGKYVKDLDFAQVRTLDCGSRRSAQHPDQELSPGARMPTLAEVFALARRYRAH
FT                   DVRFNVETKVEAAAPHETAPREQFVDVTWREIRRSGFERDVTIQSFDWGTLMLWRKVAP
FT                   RLPVIALTQPEFLAPGSPWTGGLDLADFGGSPARAARSFGASALSPVHGNPQNGKVGDP
FT                   DYVPFTTEALVEDAHRNGLEVIPWTVNDPATMRKLIRDGVDGLITDYPDRLRAVLEDLG
FT                   YRLPQRYHR"
     atgcgggcac tgggcgcggc actcgtggtg atgctcctgc tccccggcgc ggcctcggcc        60
     ggagccggga ccggggccgg gcacgggcac gggcacgggc acggcaagca cggcttcgac       120
     ctccaggccc accggggcgg catcgggctc accgtcgaga gcacgctcgc cgcgttcgcc       180
     aaggccctcg aggtcggcgt caccaccctg gagctggacg tccagatcac cagggacggc       240
     cgcgaggtcg tcacgcacga ccgcaggacc aaccccgcca agtgcgtcga caccgccccc       300
     gcgcgccccg gcgaccccga gttcccctac gcgggcaagt acgtcaagga cctcgacttc       360
     gcccaggtcc gcacgctcga ctgcggctcc cgccgctcgg cccagcaccc cgaccaggag       420
     ctgtcgcccg gcgcccggat gcccaccctc gccgaggtgt tcgccctcgc ccgccgctac       480
     cgcgcgcacg acgtccggtt caacgtcgag accaaggtcg aggccgccgc gccgcacgag       540
     accgcgccgc gcgagcagtt cgtcgacgtc acctggcgcg agatccgccg ctccggcttc       600
     gagcgcgacg tgaccatcca gtccttcgac tgggggaccc tgatgctgtg gcggaaggtc       660
     gcaccgcgac tgccggtgat cgccctgacc cagcccgagt tcctcgcccc cggctcgccc       720
     tggaccggcg gcctcgacct ggccgacttc ggcggcagcc cggcccgcgc cgcccgcagc       780
     ttcggcgcct ccgcgctgtc cccggtgcac ggcaacccgc agaacggcaa ggtcggcgac       840
     cccgactacg tcccgttcac caccgaggcc ctggtcgagg acgcgcaccg gaacggcctc       900
     gaggtcatcc cgtggaccgt caacgacccc gccaccatgc gcaagctcat ccgcgacggc       960
     gtggacggcc tgatcaccga ctaccccgac cggctgcgcg ccgtcctcga ggacctcggc      1020
     taccgcctgc cccagcgcta ccaccgctga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page