(data stored in ACNUC7421 zone)

EMBL: CP001630.PE77

CP001630.PE77        Location/Qualifiers
FT   CDS_pept        complement(85244..86476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0077"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: jan:Jann_1726
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34051"
FT                   /db_xref="GOA:C6WDQ6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ6"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU34051.1"
FT                   /translation="MDASGPQDLPSGVVAPFDQNDPSFIADPYPVFAALRVQGEVHWHD
FT                   GMGLAVAVSHAASSAVLRHRSLGRLWTDAKPLEEFASFNLLHRNSLLENEGATHARLRR
FT                   LVSAAFGRGHVERLRPRIAELADGLVDGLVDRVRADGSADLLEHVAGPLPVEVIAELLG
FT                   VPHSERSLLQPWSNAIVKMYEHGLAEDKRAAAERAAREFVAYLREVVALRRRQPGDDLV
FT                   SDLVAVTDSDGARLSEDELVATAVLLLMAGHEATVNVIGNGVLALVEHRDQWERLVADP
FT                   GLLETAVEELIRYDSPLQLFERTATKREEIAGHVVEEGAKIAALLGAAARDPEVFERPD
FT                   EFDVGRTPNQHLGFGMGIHYCLGAPLARIEVQAAVDALRRKLPGMELAATPRRREEFVI
FT                   RGLHELPLGAG"
     atggacgcga gcggtcctca agacctaccg tccggggtcg tggcgccttt cgaccagaac        60
     gacccctcct tcatcgcgga cccgtacccg gtcttcgccg cgctgcgcgt ccagggcgag       120
     gtgcactggc acgacggcat ggggctcgcg gtcgcggtgt cccacgccgc gtcgtcggcg       180
     gtgctgcggc accggagcct cggacggctg tggacggacg ccaagccgct ggaggagttc       240
     gcctcgttca acctgctgca ccggaactcg ctgctggaga acgagggcgc gacgcacgcc       300
     cggctgcggc ggctggtgtc ggcggcgttc gggcgcgggc acgtggagcg gttgcggccc       360
     cggatcgcgg agctggcgga cgggctggtc gacgggctgg tcgaccgggt gcgcgcggac       420
     gggtcggccg acctgctgga gcacgtggcc ggaccgctgc cggtggaggt gatcgccgag       480
     ctgctggggg tgccgcactc ggagcggtcg ctgctccagc cgtggtcgaa cgcgatcgtg       540
     aagatgtacg agcacgggct ggccgaggac aagcgggcgg cggcggagcg ggcggcgcgg       600
     gagttcgtgg cgtacctgcg ggaggtcgtg gcgctgcggc ggcggcagcc gggcgacgac       660
     ctggtgtccg acctggtcgc ggtgaccgac tcggacgggg cccggctgag cgaggacgag       720
     ctggtggcca cggcggtgct gctgctgatg gcggggcacg aggcgaccgt gaacgtgatc       780
     ggcaacgggg tgctggcgct ggtggagcac cgcgaccagt gggagcggct ggtggccgac       840
     cccggcctgc tggagaccgc cgtcgaggag ctgatccggt acgactcgcc gctccagctg       900
     ttcgagcgga ccgcgaccaa gcgggaggag atcgccgggc acgtggtgga ggagggcgcg       960
     aagatcgcgg ccctgctcgg cgcggcggcg cgcgaccccg aggtgttcga gcggccggac      1020
     gagttcgacg tggggcgcac gcccaaccag cacctcgggt tcggcatggg catccactac      1080
     tgcctgggcg cgccgctggc ccggatcgag gtgcaggcgg cggtggacgc gctgcggcgc      1140
     aagctgccgg ggatggagct ggcggcgacg ccgaggcggc gggaggagtt cgtgatccgg      1200
     gggctgcacg agctgccgct gggcgcgggc tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page