(data stored in ACNUC7421 zone)

EMBL: CP001630.PE78

CP001630.PE78        Location/Qualifiers
FT   CDS_pept        86596..87294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0078"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: gbm:Gbem_3150 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34052"
FT                   /db_xref="GOA:C6WDQ7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34052.1"
FT                   /translation="MSPEVVAHRGASAALPEHTLAAYELAIAEGADALECDVRLTRDEQ
FT                   LVCVHDRTVSRTSDGRGAVGALTLAELRALDFGSWHGGDPAPVLTFAELAGLAADHGTP
FT                   LFVETKHPVRTGGLVETRLAQELARHSLDVHMMSFSALAVRRFKALAPAVPTVWLLDRL
FT                   WPQRLPEWADLPGPGVSLLRRSPGRGRGAYCWTVDTAPDIDLCRERGVRHLATNHPART
FT                   RKILAADLAP"
     gtgtcccccg aagtggtcgc ccaccgaggc gcctccgcgg ccctgcccga gcacaccctc        60
     gccgcctacg agctggcgat cgccgagggc gccgacgccc tggagtgcga cgtccgcctg       120
     accagggacg agcagctggt ctgcgtccac gaccgcaccg tctcccgcac cagcgacgga       180
     cggggcgcgg tcggcgcgct caccctcgcc gagctgcgcg cgctcgactt cggctcctgg       240
     cacggcggcg acccggcccc cgtgctgacc ttcgcggagc tggcgggcct ggccgccgac       300
     cacgggaccc cgctgttcgt cgagaccaag cacccggtgc gcaccggcgg gctggtggag       360
     accaggctcg cgcaggagct ggcccggcac tcgctggacg tgcacatgat gtcgttctcc       420
     gcgctcgcgg tgcgccgctt caaagcgctc gcgcccgccg ttcccacggt ctggctgctc       480
     gaccggctgt ggccccagcg gctacccgaa tgggcggatc tgccggggcc cggcgtgtcc       540
     ctgctgcgcc gctcgccggg acgcggccgg ggtgcttact gctggaccgt ggacacggcg       600
     cccgacatcg acctgtgccg cgagcggggc gtgcgccacc tggcgaccaa ccacccggcg       660
     cgaacccgca agatccttgc ggcagacttg gccccctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page