(data stored in ACNUC7421 zone)

EMBL: CP001630.PE79

CP001630.PE79        Location/Qualifiers
FT   CDS_pept        87313..88257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0079"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34053"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ8"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU34053.1"
FT                   /translation="MAKRTAVKSKSADGVNPRQPCPCGSGKRYKACHGGADGGADVIVA
FT                   RPFAGLASEAELIALREFVPSATVKLPLKDAPREVVLASVLPMAAAGLVRADGTAFVGL
FT                   QVQTRSGDLSRDLARAVQWAYTAETGDVLPVVGPEDGTNPGRLQDLLDVEASVSPELHA
FT                   DFAWWMPPGNEPAGDVALSLERANAAILPTERVDAPGVTAAYWVDAGDKAHLRWVRPEP
FT                   EEQLLAALARLSVRGELDLGDGTRYAGSFRAHGLLVPVWDLDRESHSSEWAGPAEALGK
FT                   RLLDALASLDSEPLSEAERRSRDGLRGRQITLR"
     gtggccaagc ggacggctgt gaagagcaag tcggcggacg gggtgaaccc gcgccagccg        60
     tgcccgtgcg gctccggcaa gcgctacaag gcgtgccacg ggggcgcgga cggcggggcc       120
     gacgtcatcg tcgcccggcc cttcgcgggg ctggcgtcgg aggcggagct gatcgcgctg       180
     cgggagttcg tgccctcggc gaccgtgaag ctgccgctca aggacgcgcc gcgcgaggtc       240
     gtgctggcct cggtgctgcc gatggccgcc gcagggctgg tgcgcgccga cggcaccgcg       300
     ttcgtgggcc tgcaggtgca gacccgctcc ggcgacctga gccgcgacct ggcccgcgcc       360
     gtgcagtggg cctacaccgc cgagaccggc gacgtgctgc ccgtggtcgg cccggaggac       420
     gggaccaacc ccggtcgcct gcaggacctg ctggacgtcg aggcgtcggt cagccccgag       480
     ctgcacgccg acttcgcgtg gtggatgccg ccgggcaacg agcccgccgg tgacgtcgcg       540
     ctgtccctgg agcgggcgaa cgcggcgatc ctgccgaccg agcgggtcga cgcgcccggc       600
     gtgacggccg cctactgggt ggacgcgggc gacaaggcgc acctgcgctg ggtgcgcccg       660
     gagccggagg agcagctgct ggcggcgctg gcgcggctgt ccgtgcgcgg tgagctggac       720
     ctgggcgacg gcacccgcta cgcgggctcg ttccgcgcgc acggcctgct cgtgccggtg       780
     tgggacctgg accgtgagtc gcactccagc gagtgggccg gtccggccga ggcgctgggc       840
     aagcggctgc tggacgcgct ggcgagcctg gactccgagc cgctgagcga ggcggagcgg       900
     cggtcgcggg acggcctgcg gggacggcag atcaccctcc gctag                       945
//

If you have problems or comments...

PBIL Back to PBIL home page