(data stored in ACNUC7421 zone)

EMBL: CP001630.PE8

CP001630.PE8         Location/Qualifiers
FT   CDS_pept        11278..12144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33982"
FT                   /db_xref="GOA:C6WCG1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33982.1"
FT                   /translation="MTPPEKEDRDADKTAVITRPSVEAAKAPEAAAASSGEPEKKPEEV
FT                   VTTAVPAAAPEAAKAPEKPAEKPVDESPTVAVTPPPWQRSTSEGGYSEAAQVGPGDDVK
FT                   PAEAGAPASPVFPSLDQDTVAVAKPVPPGAAPAAAAAAAAPRTAVNLGTQSRPQASSSA
FT                   RRPGRGPRRASLQVKRVDPWSVLKLALVLSVALFFVWLVAVGVLYGVLNGMGVWDKINN
FT                   TANDLLQSEEASGDPLISAGRVFGVSAIVGAVNIVLFTALATVGAFVYNVSADLAGGLE
FT                   VTLSERE"
     gtgactccac ccgagaaaga ggaccgggac gcggacaaga ccgcggtgat cacccggccg        60
     agcgtcgagg cggccaaggc gcccgaggcg gcagccgcgt catcgggtga accggagaag       120
     aagccggagg aggtcgtgac caccgccgtg cccgccgccg ctccggaggc cgcgaaggcc       180
     ccggagaagc ccgcggagaa gcccgtggac gagagcccca cggtggcggt gacgcccccg       240
     ccgtggcagc ggtcgaccag cgagggcggc tacagcgagg ccgcccaggt cgggccgggc       300
     gacgacgtga agcccgccga ggcgggggcc ccggcgtcgc cggtcttccc gtcgctggac       360
     caggacacgg tggcggtggc caagccggtc ccgcccggcg ccgctccggc ggctgccgcg       420
     gcggcggcgg cgccgcgcac agcggtgaac ctgggcaccc agtcgaggcc gcaggcgtcg       480
     tcctcggcgc gccgtcccgg caggggaccc cggcgggcca gcctgcaggt gaagcgggtc       540
     gacccgtggt cggtcctgaa gctcgcgctg gtgctcagcg tggcgctgtt cttcgtctgg       600
     ctggtcgcgg tcggcgtgct gtacggcgtg ctgaacggca tgggcgtgtg ggacaagatc       660
     aacaacaccg cgaacgacct cctccagagc gaggaggcca gcggtgaccc gttgatcagc       720
     gcgggtcggg tgttcggcgt gtccgccatc gtgggcgcgg tcaacatcgt cctgttcacc       780
     gcgctggcca ccgtgggcgc cttcgtctac aacgtctcgg ccgatctcgc aggcggcttg       840
     gaggtcacgc tctccgagcg tgagtga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page