(data stored in ACNUC7421 zone)

EMBL: CP001630.PE80

CP001630.PE80        Location/Qualifiers
FT   CDS_pept        88330..88656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0080"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   rru:Rru_A0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34054"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ9"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACU34054.1"
FT                   /translation="MLLRISTRADWAEARESGAIPLDLEGFVHCADPGTVHLPANSLYR
FT                   NRSGLVLLVVDPEGLPVLYEPGDGDESGPWFPHVYGPIPADSVVAVLDFEPDPDGVFRP
FT                   PPVL"
     gtgctcctgc ggatcagcac gcgggcggac tgggcggagg cgagggagag cggggcgatc        60
     ccgctcgacc tggaggggtt cgtgcactgc gcggaccccg gaaccgtcca cctgcccgcg       120
     aactcgctct accggaaccg gtccgggctg gtcctcctgg tcgtcgaccc ggagggcctg       180
     cccgtgctgt acgagccggg ggacggcgac gagtccggcc cctggttccc gcacgtgtac       240
     ggcccgatcc cggccgactc ggtggtcgcg gtgctggact tcgaaccgga tccggacgga       300
     gtcttccgcc ctccacccgt tctgtag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page