(data stored in ACNUC7421 zone)

EMBL: CP001630.PE81

CP001630.PE81        Location/Qualifiers
FT   CDS_pept        88777..89808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0081"
FT                   /product="Phenylacetaldoxime dehydratase"
FT                   /EC_number="4.99.1.7"
FT                   /note="KEGG: xau:Xaut_1560 phenylacetaldoxime dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34055"
FT                   /db_xref="GOA:C6WDR0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR0"
FT                   /inference="protein motif:PRIAM:4.99.1.7"
FT                   /protein_id="ACU34055.1"
FT                   /translation="MSSLPLDDRATAHRPEGYDPRGGPGHEVRWSDDVTHLVVARFGVQ
FT                   TDDSAAGVKAIARVLELAAGESGPALVERVSDDDSEMAVCYWPDPEAHRAWWASGPVRD
FT                   WWASLPVDGPIGHWHETSVTPVEQFETLYSAEFAAGPSRFAGTGPTNLHDYDNSTLDRM
FT                   PATAHRDLRQERAEEPTTDLPPGESPRGRRVRLAEPSPSGLCWIRTAQEWSIAPDDQLA
FT                   SYRDGVEPAYRTAIAHLQDNPHDTGCLSARLVGNLDANGARAAGAEAVVWWRGIGDLLR
FT                   WAHDHKTHQDILNGFWEHVIAKFGPGTRVRLWHEVHVLPEGALTAEYVNCHPGTGLLQT
FT                   WPG"
     ttgtcttccc tgccactgga cgaccgggcg accgcccacc ggccggaggg gtacgacccg        60
     cgcggcggtc ccggccacga ggtgcgctgg tccgacgacg tcacgcacct cgtcgtggcc       120
     cgcttcggcg tccagaccga cgactcggcg gccggcgtga aggccatcgc ccgcgtgctg       180
     gagctggcgg cgggcgagag cggcccggcc ctggtcgagc gggtcagcga cgacgacagc       240
     gagatggccg tctgctactg gccggacccc gaggcgcacc gcgcctggtg ggcgagcggg       300
     ccggtgcgcg actggtgggc gtccctgccc gtcgacgggc cgatcgggca ctggcacgag       360
     acctcggtga ccccggtcga gcagttcgag acgctctact cggccgagtt cgcggcaggc       420
     ccctcccgct tcgccgggac cggccccacg aacctgcacg actacgacaa ctccaccctg       480
     gaccggatgc ccgccacggc gcaccgcgac ctcaggcagg agcgcgccga ggagcccacc       540
     acggacctgc cgcccggcga gtcgccgcgc ggtcggcggg tcaggctggc cgagccctcg       600
     ccctccggcc tgtgctggat ccgcaccgcc caggagtggt cgatcgcgcc ggacgaccag       660
     ctggcctcct accgggacgg ggtcgagccc gcgtaccgca cggccatcgc gcacctccag       720
     gacaacccgc acgacaccgg ctgcctgtcc gcccggctgg tgggcaacct ggacgccaac       780
     ggcgcgcggg cggcgggcgc cgaggcggtc gtgtggtggc gcggcatcgg cgacctgctg       840
     cgctgggcgc acgaccacaa gacgcaccag gacatcctga acgggttctg ggagcacgtg       900
     atcgccaagt tcggccccgg cacgcgggtg cggctgtggc acgaggtgca cgtgctgccc       960
     gagggcgcgc tgaccgccga gtacgtcaac tgccaccccg gcacggggct gctccagacc      1020
     tggcccggct ga                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page