(data stored in ACNUC7421 zone)

EMBL: CP001630.PE82

CP001630.PE82        Location/Qualifiers
FT   CDS_pept        complement(89920..90483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0082"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34056"
FT                   /db_xref="GOA:C6WDR1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR1"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34056.1"
FT                   /translation="MALNLKKLPTETSSKFRALLQEQIGNEFTASQQYTAIAVWYDSRD
FT                   LPRLAAHFYAQALEERNHAMMLVKYLLDTDVPVTIPGVGEVRNDFGSAREPVELALAQE
FT                   KTVTEQIVALAKAARDEGDYLGEQFLQWFLKEQVEEVSSMSTLLTVVDRADGNLFHVEN
FT                   FVARELSGAGGDDPTAPAAAGGAL"
     atggccctga acctgaagaa gctgcccacc gaaacctcct cgaagttccg agcactgctc        60
     caggagcaga tcgggaacga gttcaccgcc tcgcagcagt acaccgcgat cgcggtctgg       120
     tacgactccc gcgacctccc ccggctcgcc gcgcacttct acgcgcaggc gctggaggag       180
     cgcaaccacg ccatgatgct ggtcaagtac ctgctcgaca cggacgtgcc ggtgaccatc       240
     cccggcgtcg gcgaggtgcg caacgacttc ggctcggcgc gcgagcccgt cgagctggcg       300
     ctggcgcagg agaagaccgt caccgagcag atcgtcgcgc tggccaaggc cgcccgcgac       360
     gagggcgact acctgggcga gcagttcctc cagtggttcc tcaaggagca ggtggaggag       420
     gtgtcgtcga tgagcacgct gctgaccgtg gtggaccgcg ccgacggcaa cctgttccac       480
     gtggagaact tcgtcgcccg cgagctgagc ggcgccgggg gcgacgaccc gaccgccccc       540
     gccgcggcgg gtggcgcgct ctaa                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page