(data stored in ACNUC7421 zone)

EMBL: CP001630.PE83

CP001630.PE83        Location/Qualifiers
FT   CDS_pept        complement(90632..91879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0083"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="KEGG: ses:SARI_03184 arginine deiminase; TIGRFAM:
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34057"
FT                   /db_xref="GOA:C6WDR2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR2"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ACU34057.1"
FT                   /translation="MTAHIEHTQSATPAPGPAPRVDSEVGPLRTVLLHRPGAELKRLTP
FT                   RNNDQLLFDGVPWVDRAQEEHDAFAGVLRSRGVEVLLLGDELVRALHDDRARIAGVHSA
FT                   VDERRLGIHLADALRSHLSGLAPEALATILTSGMTFEELPAAEGASLVRRMHQPGDFAV
FT                   DPLPNLLFTRDSSVWVGDRVAITSLAMPARGRETALTDLIYAYHPRFAKTGRAYGAHSA
FT                   PLEGGDVLLLAPGVLAIGVGERTTPAGAESFARSALADGLAHTVLAVPIAQQRATMHLD
FT                   TVCTMVDRDAVVMYPAVRDNLFAYPVRQDGSGGVRVSGPSPFLEAAAEAMGIDRLRVID
FT                   TGLDAVTAEREQWDDGNNTLAVGPGLVVAYERNVETNARLEEAGVEVLRISGSELGSGR
FT                   GGPRCMSCPIDRAPLV"
     gtgaccgcgc acatcgagca cacccagtcc gccacccccg cgcccggacc ggcgcccagg        60
     gtggacagcg aggtcggccc gctgcgcacg gtgctgctgc accggccggg ggccgagctg       120
     aagcggctga ccccgcgcaa caacgaccag ctcctgttcg acggcgtccc ctgggtcgac       180
     cgggcgcagg aggagcacga cgcgttcgcc ggggtgctgc gctcgcgcgg cgtcgaggtg       240
     ctgctgctcg gggacgagct ggtgcgggcg ctgcacgacg accgggcgcg catcgcgggc       300
     gtgcacagcg cggtggacga gcgccgcctg ggcatccacc tggcggacgc gctgcgctcg       360
     cacctgtccg gcctggcccc cgaggcgctg gcgaccatcc tgaccagcgg catgaccttc       420
     gaggagctgc ccgccgccga gggggcctcg ctggtgcgcc ggatgcacca gcccggcgac       480
     ttcgccgtcg acccgctgcc gaacctgctg ttcacccgcg actcgtcggt gtgggtgggc       540
     gaccgggtgg cgatcacctc gctggcgatg cccgcgcgcg gcagggagac cgcgctgacc       600
     gacctgatct acgcctacca cccgcgcttc gcgaagaccg gccgcgccta cggggcgcac       660
     tcggccccgc tggagggcgg cgacgtgctg ctgctcgcgc cgggcgtgct ggccatcggc       720
     gtcggcgagc ggaccacgcc cgcgggcgcc gagtcgttcg cccgctcggc gctggccgac       780
     gggctggcgc acaccgtgct cgccgtgccg atcgcgcagc agcgggccac gatgcacctg       840
     gacacggtgt gcacgatggt cgaccgggac gccgtggtga tgtacccggc ggtgcgggac       900
     aacctgttcg cctacccggt gcgccaggac ggctcgggcg gggtgcgggt gtccgggccg       960
     agcccgttcc tggaggcggc ggcggaggcg atgggcatcg accggctgcg ggtgatcgac      1020
     accgggctgg acgcggtgac cgccgagcgc gagcagtggg acgacgggaa caacacgctc      1080
     gccgtgggcc ccggcctggt ggtggcgtac gagcggaacg tggagaccaa cgcgcgcctg      1140
     gaggaggcgg gggtcgaggt gctgcggatc agcggttcgg aactgggctc cggtcggggc      1200
     gggccgcgct gcatgtcgtg cccgatcgac cgcgcgccgc tggtctga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page