(data stored in ACNUC7421 zone)

EMBL: CP001630.PE84

CP001630.PE84        Location/Qualifiers
FT   CDS_pept        complement(92019..92672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34058"
FT                   /db_xref="GOA:C6WDR3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR3"
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /protein_id="ACU34058.1"
FT                   /translation="MTTLADELVLICYSDEGRPSVTHPILGYGVTGALLTELVLAGRVD
FT                   LVDKKVVVTDPTPTGEPAVDALLARLAGADKPRKPQQWMHKLYKESTTQVLDGLVERGV
FT                   VRREEAKVLLVFPTTRYPTPDGRQPALEADARARLRAALEGDGPVDERTAALCALVGAA
FT                   RQERKVLPDVPKDRLKARLKEISQGAWASDAVRRAIDEIQVALVAGAAVAAAGA"
     atgacgacgc tcgccgacga actggtcctc atctgctact cggacgaggg caggccctcg        60
     gtcacccacc cgatcctcgg ctacggggtg accggcgcgc tgctcaccga gctggtgctg       120
     gcgggccggg tcgacctggt ggacaagaag gtcgtggtca ccgacccgac gcccaccggc       180
     gaaccggccg tggacgccct gctggcccgg ctcgccgggg cggacaagcc gcgcaagccg       240
     cagcagtgga tgcacaagct ctacaaggag agcacgacgc aggtgctcga cggcctcgtg       300
     gagcgcggcg tggtccgccg cgaggaggcc aaggtgctgc tggtcttccc gaccacccgg       360
     tacccgacgc cggacggcag gcagcccgcg ctggaggcgg acgcgcgcgc ccggctgcgc       420
     gccgcgctgg agggcgacgg cccggtggac gagcgcacgg ccgcgctgtg cgcgctggtc       480
     ggggcggcca ggcaggagcg gaaggtgctc cccgacgtgc cgaaggaccg gctcaaggcc       540
     aggctgaagg agatcagcca gggcgcctgg gcctcggacg cggtgcgcag ggccatcgac       600
     gagatccagg tggcgctggt ggcgggcgcg gccgtggccg ccgccggggc ctga             654
//

If you have problems or comments...

PBIL Back to PBIL home page