(data stored in ACNUC7421 zone)

EMBL: CP001630.PE85

CP001630.PE85        Location/Qualifiers
FT   CDS_pept        complement(92746..93540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0085"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   dal:Dalk_0566 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34059"
FT                   /db_xref="GOA:C6WDR4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR4"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACU34059.1"
FT                   /translation="MIDQTRGPGELGPERFTPDQRRGYQVELLLVFSVTLGLSGLRSLV
FT                   RLVDSLLRPVPLNQQTVAINVPQARFDLLDLIAQLLSVLQLSAWGGLGLYLLWRSGVTF
FT                   KAVGLDRARPVFDAWGSLGLAALIGIPGLAFYLVAWNLGLNLAVQPSTLDSWWSAITLT
FT                   LAAAGNAWAEEVLVVGFILTRLRQLGWKDNTSLVVAAVLRGSYHLYQGFGGFIGNVVMG
FT                   LVYGRFWQRTGRLWPLIGAHTLLDVVAFVGYSLLRDHLSWLP"
     gtgatcgacc agacgagggg gccgggcgag ctcgggcccg agcggttcac gcccgaccag        60
     cgcaggggct accaggtcga gctgctgctc gtcttcagcg tcaccctcgg cctgtccggg       120
     ctgcgcagcc tggtgcggct ggtggacagc ctgctgcggc cggtcccgct caaccagcag       180
     acggtggcga tcaacgtccc gcaggcgcgg ttcgacctgc tcgacctgat cgcccagctg       240
     ctgagcgtgc tccagctgtc cgcgtggggc gggctcggcc tgtacctgct gtggcgcagc       300
     ggggtgacgt tcaaggccgt cggcctggac cgggcccggc cggtgttcga cgcgtggggc       360
     agcctggggc tggccgcgct gatcggaatc cccggactgg cgttctacct cgtggcctgg       420
     aacctggggc tgaacctggc cgtgcagccg tccacgctgg actcctggtg gagcgcgatc       480
     acgctgaccc tggcggcggc gggcaacgcg tgggccgagg aggtcctggt cgtcgggttc       540
     atcctgaccc ggctgcggca gctggggtgg aaggacaaca cctcgctggt ggtcgctgcc       600
     gtgctgcgcg gctcgtacca cctgtaccag gggttcggcg ggttcatcgg caacgtcgtg       660
     atgggcctgg tctacgggag gttctggcag cggaccgggc ggctgtggcc cctgatcggc       720
     gcgcacaccc tgctcgacgt ggtcgccttc gtcggctact cgctgctgcg cgaccacctg       780
     tcctggctgc cctga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page