(data stored in ACNUC7421 zone)

EMBL: CP001630.PE86

CP001630.PE86        Location/Qualifiers
FT   CDS_pept        complement(93550..94308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34060"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34060.1"
FT                   /translation="MTEIRRPPAPHPAERARTIATRGGRAALLPPDGAEDRVVPELHHV
FT                   HACGEATLLLPDEHPLVARAALGEVTSMLEIADHAAVPLREPVRGLLWITGWLRALDGP
FT                   DAREACVEVAEERPDPRLLDVGHGLTALRLVPASLVVADAETTTSLRPEVFAQAEPDPF
FT                   CAHEDHWLRHLELSHRDVVGLLVQHLPEGLRGGHVRPLGLDRFGLRLRVELEDTDHDVR
FT                   IAFSRPVATPSELSSELRRLMGCPFLAQRR"
     gtgaccgaga tccgcagacc acccgcgccg caccctgccg agcgcgcgcg gaccatcgcc        60
     accaggggtg ggcgcgccgc gctgctgccg ccggacggcg ccgaggaccg ggtggtgccg       120
     gagctgcacc acgtgcacgc ctgcggcgag gcgaccctgc tgctgcccga cgagcacccg       180
     ctggtggcgc gcgccgcgct cggcgaggtg acctcgatgc tggagatcgc cgaccacgcc       240
     gccgtgccgc tgcgcgagcc ggtgcgcggc ctgctgtgga tcaccggctg gctgcgcgcg       300
     ctcgacgggc cggacgcccg cgaggcctgc gtggaggtcg ccgaggagcg ccccgacccg       360
     cgcctgctcg acgtcggcca cgggctgacc gcgctgcgcc tggtcccggc ctccctggtg       420
     gtcgccgacg cggagaccac gacctcgctg cgccccgagg tgttcgccca ggccgagccc       480
     gacccgttct gcgcgcacga ggaccactgg ctgcgccacc tggagctctc gcaccgggac       540
     gtggtgggcc tgctggtgca gcacctgccc gaggggctgc gcggcgggca cgtccggccg       600
     ctcggcctcg accggttcgg cctgcggctg cgggtggagc tggaggacac cgaccacgac       660
     gtgcggatcg cgttctcccg cccggtggcg accccgtccg agttgtcctc ggagctgcgc       720
     aggctgatgg gctgcccgtt cctggcgcag cgccgctaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page