(data stored in ACNUC7421 zone)

EMBL: CP001630.PE87

CP001630.PE87        Location/Qualifiers
FT   CDS_pept        94407..95036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34061"
FT                   /db_xref="GOA:C6WDR6"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34061.1"
FT                   /translation="MVVPNQPSTEGAAIDDRWTHHCLETASRRVFGWVVLGALAFTAQL
FT                   VLVLWSDVPSHVPFALLAFSLGSIAWGLVRRPSPAGAMREEPWRFARVHWSNGRLVVHG
FT                   EEKSSVLEVRGAGPLVRGRIGKHRRAWLVLPDRQGNTVVTFRGVPKLFPARVLRAPVRR
FT                   GTGKAAGSSGAAGAGSAKGVKAGRTRRGTTRRGAKERGTGRDRSQG"
     gtggtcgtgc ccaaccagcc gtccaccgaa ggggcggcta tcgatgaccg ctggacccac        60
     cactgccttg agacggccag ccggcgggtg ttcggctggg tcgtcctcgg ggcgctggcg       120
     ttcaccgctc aactggtgct ggtcctctgg tccgacgtgc cctcgcacgt cccgttcgcg       180
     ctgctcgcgt tctcgctcgg ctccatagcc tggggcctgg tgcgcaggcc gtcgcccgcg       240
     ggggcgatgc gcgaggagcc gtggcggttc gcgcgggtcc attggagcaa cggcaggctc       300
     gtcgtgcacg gcgaggagaa gtcctcggtg ctggaggtgc gcggcgcggg cccgctggtg       360
     cgcggccgga tcggcaagca ccgcagggcc tggctcgtgc tcccggaccg gcagggcaac       420
     accgtggtga cgttccgggg cgtgccgaag ctgttcccgg cgcgggtgct gcgcgcgccc       480
     gtgcggcgcg ggaccggcaa ggccgccggg tcctcggggg cggcgggcgc cgggtcggcg       540
     aagggcgtga aggccgggcg cacccggcgc gggaccaccc ggaggggcgc gaaggagcgc       600
     ggcacggggc gtgaccgctc gcagggctga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page