(data stored in ACNUC7421 zone)

EMBL: CP001630.PE88

CP001630.PE88        Location/Qualifiers
FT   CDS_pept        complement(95197..96399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0088"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /note="PFAM: homogentisate 12-dioxygenase; KEGG:
FT                   bcz:BCZK0217 homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34062"
FT                   /db_xref="GOA:C6WDR7"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR7"
FT                   /inference="protein motif:PFAM:PF04209"
FT                   /protein_id="ACU34062.1"
FT                   /translation="MPYYRQVGDIPRKRHTQFRSPDGSLYAEELMGVEGFSADSALLYH
FT                   RHLPTAIVDAVTVPDTRGPLVPNLPLKPRHFRTEPLVGSDPGGPGGPGGAADAVTGRRV
FT                   LFGNADVVICFAAATEPSPLYRNAFGDELLYVQSGEGVVETIYGALVVESGDYVVLPTS
FT                   CTYRLAPRTPMRLLVLEATGHIGPPKRYLSARGQFLEHSPYCERDLRGPAEPLLVDGED
FT                   VDVLVRHRAGLTRMTYAAHPFDVVGWDGCLYPWVFNIGDFEPITGRVHQPPPVHQTFEG
FT                   PNFVVCSFVPRKVDYHPLAVPVPYNHANVDSDELMFYVGGDYEARKGSGIGLGSLSLHP
FT                   AGCAHGPQPGAVEASLGAESFDETAVMVDTFRPLELGEAALAGEDARYAWSWSRRGPDL
FT                   D"
     atgccgtact accgccaggt cggggacatc ccccgaaagc gccacaccca gttccgctct        60
     ccggacggct ccctgtacgc ggaggagctg atgggggtgg agggcttctc ggccgattcg       120
     gccctgctct accaccgcca cctgccgacc gcgatcgtcg acgcggtgac cgtcccggac       180
     acccgcggac ccctcgtccc gaacctgccg ctcaagcccc gccacttccg gaccgaaccc       240
     ctggtcgggt cggaccctgg cggccctggc ggccctggcg gcgcggccga cgcggtgacc       300
     ggccgcaggg tgctgttcgg caacgccgac gtggtgatct gcttcgccgc cgccaccgag       360
     cccagcccgc tctaccgcaa cgccttcggc gacgagctgc tgtacgtgca gtccggcgag       420
     ggcgtggtcg agacgatcta cggcgcgctg gtggtcgagt ccggggacta cgtggtgctc       480
     ccgacctcct gcacctaccg gctggcgccc cggacgccga tgcgcctgct cgtgctggag       540
     gccaccgggc acatcgggcc cccgaagcgg tacctgtcgg cgcgcgggca gttcctggag       600
     cactcgccgt actgcgagcg ggacctgcgc gggcccgccg agccgctgct ggtggacggc       660
     gaggacgtgg acgtgctggt gcggcaccgc gccgggctga ccaggatgac ctacgcggcg       720
     cacccgttcg acgtggtggg ctgggacggc tgcctgtacc cgtgggtgtt caacatcggg       780
     gacttcgagc cgatcaccgg gcgggtgcac cagccgccgc cggtgcacca gacgttcgag       840
     ggtcccaact tcgtggtgtg ctcgttcgtg ccgcgcaagg tcgactacca cccgctggcc       900
     gtgccggtgc cgtacaacca cgcgaacgtc gactcggacg agctgatgtt ctacgtgggc       960
     ggggactacg aggcgcgcaa gggctccggc atcgggctcg ggtcgctgtc gctgcacccg      1020
     gcgggctgcg cgcacgggcc gcagccgggg gcggtggagg cgtcgctggg cgcggagtcg      1080
     ttcgacgaga ccgccgtcat ggtggacacg ttccgaccgc tggagctggg cgaggcggcg      1140
     ctggcgggcg aggacgcccg gtacgcgtgg tcgtggtcgc gccggggacc ggacctggac      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page