(data stored in ACNUC7421 zone)

EMBL: CP001630.PE89

CP001630.PE89        Location/Qualifiers
FT   CDS_pept        96535..97335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34063.1"
FT                   /translation="MDDAALFPPGDATMADAVRGYLDSRSGDWAGPLNLFLCPASRLAE
FT                   LITELIKVKPVKPVALSLVIDTGLGGVPKAVSIVESRSELLALRMVEMPAPSDVDEVWL
FT                   ERVSEFVPEDVIRVVEPRRGGAEWLDGVRRVIEHGSWPKLRCGGMRKENFPSVDEVADF
FT                   LAVVSGGGVAFKATAGLHHAVRHEDPETGFTHHGFLNLLVATARSLSGGDVRAALSSTD
FT                   AEALTAEAKALSDQAAHAVRGVFASYGSCSLADPIRDLEELGLL"
     gtggacgacg ccgcgctgtt ccctcccggc gacgcgacca tggccgacgc cgtgcgcggt        60
     tacctggact cgcgctccgg cgactgggcc ggaccgctga acctcttcct gtgcccagcc       120
     tcccggctgg ccgagctgat caccgagctg atcaaggtga agccggtcaa accggtcgcc       180
     ctgtcgctcg tgatcgacac cggtctcggc ggggtcccga aggcggtgtc gatcgtggaa       240
     tcgcgcagcg agctgctcgc gctgcgcatg gtcgagatgc ccgccccctc cgacgtggac       300
     gaggtgtggc tggagcgcgt ctcggagttc gtccccgagg acgtcatccg cgtggtcgaa       360
     ccgcgcaggg gcggcgccga gtggctcgac ggggtgcgcc gcgtcatcga gcacgggagc       420
     tggcccaagc tgcgctgcgg cgggatgcgc aaggagaact tcccgagcgt cgacgaggtc       480
     gccgacttcc tggccgtcgt cagtggcggc ggggtggcct tcaaggcgac cgcgggcctg       540
     caccacgcgg tgcggcacga ggacccggag accgggttca cccaccacgg gttcctcaac       600
     ctgctggtcg ccaccgcccg ctcgctgtcc ggcggggacg tgcgcgccgc gctgtccagc       660
     accgacgccg aggcgctcac cgccgaggcc aaggcgctgt ccgaccaggc cgcccacgcg       720
     gtgcgcggcg tgttcgcctc ctacggctcg tgctcgctgg ccgacccgat ccgcgacctg       780
     gaggagctgg gcctgctgtg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page