(data stored in ACNUC7421 zone)

EMBL: CP001630.PE9

CP001630.PE9         Location/Qualifiers
FT   CDS_pept        12309..12428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33983.1"
FT                   /translation="MKKIIALVAVAGAVLFFVKRSRAAKADADLWREATAPAN"
     gtgaagaaga tcatcgcact tgtcgcagtc gccggtgcgg tcctgttctt cgtcaagcgc        60
     agtcgtgcgg ccaaggccga cgctgacctg tggcgcgagg ccactgctcc ggccaactga       120
//

If you have problems or comments...

PBIL Back to PBIL home page