(data stored in ACNUC7421 zone)

EMBL: CP001630.PE90

CP001630.PE90        Location/Qualifiers
FT   CDS_pept        97332..98516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0090"
FT                   /product="Fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; Domain of
FT                   unknown function DUF1969; KEGG: jan:Jann_1436
FT                   fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34064"
FT                   /db_xref="GOA:C6WDR9"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR9"
FT                   /inference="protein motif:PRIAM:3.7.1.2"
FT                   /protein_id="ACU34064.1"
FT                   /translation="MSWIEDPAFGPDHPFGPQTLPYGVTPDGVAVRVGDRALPLRPLAG
FT                   SFGRLADLVSAPDLDPLLRAGRPAWSELRARLVDLVTAPTAPRGAALTDLGGEILPFTV
FT                   ADYVDFYSSRHHAENVGRIFRPDGDPLLPNWTHLPVGYHGRAGTVVVSGTPVVRPRGQR
FT                   RAEGGPVFEPSARLDVEAEVGFVCGGPPESRLTPDRAADHVLGVVLVNDWSARDVQAWE
FT                   YQPLGPFLAKSFATSASAWITPLEAFSAARVAPPALPNPVLPHLAEERPWGLDLTLEVE
FT                   WNGEVVSRPPFREMSWTFAQQLAHLSSNGAPVRPGDLIASGTVSGPGVDERGSFLELTW
FT                   NGRDPVVVAGAERSFLEDGDTVRITATAPGPDGSVVGLAEVVGAVLAAAPVQGR"
     gtgagctgga tcgaggaccc ggcgttcggg ccggaccacc cgttcggacc gcaaacgctg        60
     ccctacggcg tcaccccgga cggcgtggcc gtccgggtgg gcgaccgcgc gctcccgctg       120
     cgcccgctcg ccgggtcctt cgggcggctg gccgacctgg tgtcggcgcc cgacctggac       180
     cccctgctgc gcgcgggccg tcccgcgtgg agcgagctga gggccaggct ggtcgacctg       240
     gtcaccgcgc ccaccgcccc gcgcggcgcg gcgctcaccg acctgggcgg cgagatcctg       300
     ccgttcaccg tcgccgacta cgtcgacttc tactcgtccc ggcaccacgc ggagaacgtc       360
     ggccggatct tccggccgga cggggacccg ctgctgccca actggaccca cctgccggtc       420
     ggctaccacg gcagggcggg cacggtcgtc gtgtccggca cgcccgtggt ccgcccgcgc       480
     ggccagcgcc gcgccgaggg cggcccggtc ttcgagccca gcgcccgcct ggacgtggag       540
     gccgaggtgg gcttcgtgtg cggggggccg cccgagtccc ggctcacccc cgaccgcgcc       600
     gccgaccacg tgctcggcgt cgtcctggtc aacgactggt ccgcgcgcga cgtgcaggcc       660
     tgggagtacc agccgctcgg cccgttcctg gccaagtcgt tcgccaccag cgcgtcggcc       720
     tggatcaccc cgctggaggc gttctccgcc gccagggtcg ccccgcccgc gctgcccaac       780
     ccggtgctgc cgcacctggc ggaggagcgg ccgtgggggc tcgacctgac cctggaggtc       840
     gagtggaacg gcgaggtggt ctcccggccg ccgttccgcg agatgtcctg gacgttcgcc       900
     cagcagctcg cccacctgtc gtccaacggc gccccggtgc gccccggcga cctgatcgcc       960
     tccggcaccg tctccgggcc cggcgtggac gagcgcggct cgttcctgga gctgacctgg      1020
     aacgggcgcg acccggtggt ggtcgcgggc gccgagcggt cgttcctgga ggacggggac      1080
     accgtgcgca tcaccgccac cgcccccggc cccgacgggt ccgtcgtcgg cctcgccgag      1140
     gtcgtgggcg ccgtgctggc cgccgcgccg gtccaggggc ggtag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page