(data stored in ACNUC7421 zone)

EMBL: CP001630.PE91

CP001630.PE91        Location/Qualifiers
FT   CDS_pept        98519..99178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0091"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; SMART: regulatory
FT                   protein IclR; KEGG: dac:Daci_0951 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34065"
FT                   /db_xref="GOA:C6WDS0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACU34065.1"
FT                   /translation="MSRSPEAGRADQKESSLTLERGLALLQAVADAESDAPTISELATA
FT                   IGASRAAVYRLLVPLQARGLVRREGSKVRLGLGVLRLAANVLPQLRIAAQPALRELAEA
FT                   VGATAHLTVADGAEAQAVAVVEPSWTAFHVAYRVGSRHPAHRGAAGRAIGLSTEGAQWT
FT                   VSSGELQHGAFGVAAPVRGVHGLRASVGVVSLDELVGDRVGPQVVAAAQQVADALR"
     gtgagccggt caccggaggc cgggcgcgcc gaccagaagg agagctcgct gaccctggag        60
     cggggcctcg cgctgctcca ggccgtcgcc gacgccgagt ccgacgcgcc caccatcagc       120
     gagctggcca ccgccatcgg cgcgtcccgc gcggccgtct accggctgct cgtgccgctc       180
     caggcgcgcg gcctggtccg ccgcgagggc tccaaggtcc ggctgggcct tggcgtgctg       240
     cggctggccg ccaacgtgct gccgcagctg cgcatcgccg cgcagcccgc gctgcgcgag       300
     ctcgccgagg cggtgggcgc caccgcgcac ctgacggtcg cggacggggc ggaggcgcag       360
     gcggtggccg tggtggagcc gtcgtggacg gcttttcacg tcgcctaccg cgtgggcagt       420
     cggcacccgg cgcaccgcgg ggccgccggc cgggcgatcg gcctctcgac cgagggggcg       480
     cagtggaccg tctcctcggg cgagctgcaa cacggcgcgt tcggcgtggc ggcccccgtc       540
     aggggggtgc acgggctgcg ggccagcgtc ggcgtcgtgt ccctcgacga actggtcggc       600
     gaccgggtcg gcccccaggt cgtggcggcg gcgcagcagg tcgcggacgc gctgcgctga       660
//

If you have problems or comments...

PBIL Back to PBIL home page