(data stored in ACNUC7421 zone)

EMBL: CP001630.PE92

CP001630.PE92        Location/Qualifiers
FT   CDS_pept        99260..100771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0092"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bsu:BSU38760 cytochrome bd ubiquinol oxidase (subunit
FT                   I)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34066"
FT                   /db_xref="GOA:C6WDS1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS1"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU34066.1"
FT                   /translation="MNVLDLSRWQFGITTVYHFLMVPLTIGLSLLVAAMQTAWVRTGDR
FT                   KYLAMTKFWGKLLLINFAMGVVTGIVQEFQFGMNWSAYSRFVGDVFGAPLAMEGLAAFF
FT                   VESTFLGLWIFGWDRLSKKAHLACAWAFSLATMLSAYFILAANSWMQHPVGTIISDEGR
FT                   PQLVSIGEVLTNNTTLAAFPHVIFGAFAVAAAFLVGIACWHLWKRSDEEPVWRASVKLG
FT                   AWVGIVSFVGLAITGDFQGKLMFQQQPMKMAAAEALCHTEEPAAFSIFAVGDVSRADCE
FT                   SVKSVTVPALLSFLAHNDFSSEVKGVQDLVTEYQAKYGENYPVDERLGELSGQPIDYVP
FT                   MLPVTYWGFRLMIGFGAISALVGAVALWLVRGGRQAPTGKWFPRLMLLSIATPFLGNSF
FT                   GWIFTEMGRQPFVVAPNPTGVDGVWMFTASAVSANTVGEVLTSVTVLTLLYGALAVVEG
FT                   FLLKKYVAGGVAGVMPPVKAPTGDGKDKDSDDKSDDDDDVLAFAY"
     gtgaacgtcc tcgacctgtc gcggtggcaa ttcggcatca ccaccgtcta ccacttcctg        60
     atggtgccgc tgacgatcgg tctgtcgctg ctggtcgcgg cgatgcagac ggcgtgggtg       120
     cgcacgggcg accgcaagta cctcgccatg acgaagttct ggggcaagct gctcctgatc       180
     aacttcgcca tgggcgtcgt gacgggcatc gtccaggagt tccagttcgg catgaactgg       240
     agcgcctact cgcgcttcgt cggggacgtc ttcggcgcgc cgctggcgat ggagggcctc       300
     gcggcgttct tcgtcgagtc cacgttcctc gggctgtgga tcttcggctg ggaccggctg       360
     tccaagaagg cgcacctggc gtgcgcctgg gcgttctcgc tcgcgacgat gctgtcggcc       420
     tacttcatcc tggccgccaa ctcgtggatg cagcacccgg tcggcacgat catctccgac       480
     gagggccgcc cgcagctggt ctcgatcggc gaggtgctca ccaacaacac caccctcgcg       540
     gccttcccgc acgtgatctt cggggcgttc gccgtcgccg ccgcgttcct ggtcggcatc       600
     gcctgctggc acctgtggaa gcgcagcgac gaggagcccg tgtggcgcgc ctcggtgaag       660
     ctgggcgcgt gggtcggcat cgtctcgttc gtcggcctgg cgatcaccgg cgacttccag       720
     ggcaagctga tgttccagca gcagcccatg aagatggccg ccgccgaggc gctgtgccac       780
     accgaggagc ccgccgcctt ctcgatcttc gcggtcggcg acgtgagccg cgcggactgc       840
     gagtcggtca agagcgtcac cgtcccggcc ctgctgtcct tcctggcgca caacgacttc       900
     tccagcgagg tcaagggcgt gcaggacctg gtgaccgagt accaggccaa gtacggcgag       960
     aactacccgg tcgacgagcg gctcggcgag ctgtccggcc agccgatcga ctacgtgccg      1020
     atgctgcccg tcacctactg gggcttccgc ctgatgatcg gcttcggcgc gatctcggcg      1080
     ctggtcggcg cggtggcgct gtggctggtc cggggcggca ggcaggcgcc gaccggcaag      1140
     tggttccccc ggctgatgct gctgagcatc gccaccccgt tcctgggcaa cagcttcggc      1200
     tggatcttca cggagatggg gcgccagccg ttcgtggtcg cgccgaaccc gacgggcgtc      1260
     gacggggtct ggatgttcac cgccagcgcg gtctcggcca acacggtcgg cgaggtgctg      1320
     acctcggtca ccgtgctgac cctgctgtac ggcgcgctcg cggtcgtgga gggcttcctc      1380
     ctcaagaagt acgtcgcggg cggtgtcgcc ggcgtcatgc cgccggtgaa ggccccgacc      1440
     ggcgacggca aggacaagga ctccgacgac aagagcgatg acgatgacga cgtcctcgcg      1500
     ttcgcgtact ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page