(data stored in ACNUC7421 zone)

EMBL: CP001630.PE93

CP001630.PE93        Location/Qualifiers
FT   CDS_pept        100786..101790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0093"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: glo:Glov_1209 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34067"
FT                   /db_xref="GOA:C6WDS2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS2"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACU34067.1"
FT                   /translation="METFWFCVIALFWLGFLFLEGFDFGVGMLLPVLGKDNTERRVMIN
FT                   TIGPVWDGNEVWLIVAGAATFAAFPLWYASLFSTAFLALLLFLVALIGRGVAFEYRGKV
FT                   DSERWRKNWDRVIISTSWVASFGIGFVLTTNVHGLPIDEIGDRVGGPFSYLTWQGIVGG
FT                   LAVSGFSLVHGALFTALKTEGEIRERARALVLKMAPVALLPLVVTLLLVQFEFGGPATW
FT                   GATVVVLLAAVGSLARLWAGREGQAFALMGVAVVATVIALFGAMYPNVLPSTVDPAFSL
FT                   TIENASSSSYTLTVMTWVSAFGAPAVLVYQGWTYWVFRKRIGVKNIPPVHVPS"
     gtggagacgt tctggttctg cgtgatcgcc ctgttctggc tgggcttcct cttcctggag        60
     ggtttcgact tcggcgtcgg gatgctgctg ccggttctgg gcaaggacaa caccgagcgc       120
     cgggtcatga tcaacacgat cgggccggtc tgggacggca acgaggtctg gctgatcgtc       180
     gcgggcgcgg ccacgttcgc cgccttcccg ctctggtacg cgtcgctgtt cagcaccgcg       240
     ttcctcgcgc tgctgctgtt cctggtggcg ctcatcgggc gcggcgtggc cttcgagtac       300
     cggggcaagg tcgacagcga gcgctggcgc aagaactggg accgggtgat catctccacg       360
     tcctgggtcg cctcgttcgg catcggcttc gtgctcacca cgaacgtcca cggcctcccg       420
     atcgacgaga tcggcgaccg ggtcggcggg ccgttcagct acctcacctg gcaggggatc       480
     gtcggcggcc tggccgtctc cgggttctcg ctggtccacg gtgcgttgtt caccgcgctg       540
     aagaccgagg gcgagatccg ggagcgggcc cgcgcgctgg tgctcaagat ggccccggtc       600
     gcgctgctgc cgctggtggt gaccctgctg ctggtgcagt tcgagttcgg cggccccgcc       660
     acctggggcg ccacggtcgt ggtgctgctc gcggcggtcg gctcgctggc gcggctgtgg       720
     gcggggcgcg aggggcaggc gttcgcgctg atgggcgtcg cggtcgtggc gacggtgatc       780
     gcgctgttcg gggccatgta cccgaacgtg ctgccgtcca cggtcgaccc ggcgttctcg       840
     ctgacgatcg agaacgcgtc ctccagctcg tacacgctga ccgtcatgac ctgggtgtcc       900
     gccttcggcg cgcccgccgt gctggtctac cagggctgga cctactgggt gttccgcaag       960
     cgcatcggcg tcaagaacat cccgcccgtg cacgtgccgt cgtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page