(data stored in ACNUC7421 zone)

EMBL: CP001630.PE94

CP001630.PE94        Location/Qualifiers
FT   CDS_pept        complement(102023..103051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0094"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: vvy:VV1926 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34068"
FT                   /db_xref="GOA:C6WDS3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS3"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU34068.1"
FT                   /translation="MRKTRRTGGLTCGVPPSEESPIRVFLSYAQDDDHVLGFIGPFTRA
FT                   LEQFAFSDRGRRVEVFVDRTDLVWGQEWRSGIDQAIDSAPVFLPLITNLYFDRPYCRKE
FT                   LHRFHSEADRRGVPSLLLPVVLLGHRMLTPDHEDPLVRVISERQYRDLREAMLEGSGSA
FT                   VWRRAVLALAGDLVDVVEEAERVLATAPPAPSADEDPLLGAFRERHRAVGALLAEVRTA
FT                   LSAELVAVERASVRPSVEAQRTALGVASALRVLGERFSDGCRDYEAAVAGALAPERRAG
FT                   AAALADEVAALWADERAVSDLLDRFRPLEEEYAPLRHTLRTLRRGCKSLQTALLLVERG
FT                   AG"
     gtgcggaaga ccaggagaac cggcgggcta acctgcggtg tgccgccctc ggaggagtcc        60
     cccatccgcg tcttcctgag ctacgcgcag gacgacgacc acgtgctcgg cttcatcggg       120
     ccgttcaccc gcgcgctgga gcagttcgcc ttctccgacc ggggcaggcg cgtcgaggtg       180
     ttcgtcgacc gcaccgacct ggtgtggggc caggagtggc gcagcggcat cgaccaggcg       240
     atcgacagcg cgccggtgtt cctgccgctg atcaccaacc tgtacttcga ccgcccgtac       300
     tgccgcaagg agctgcaccg cttccacagc gaggccgacc ggcggggcgt gccgtcgctg       360
     ctgctgccgg tcgtgctgct cgggcaccgg atgctcaccc ccgaccacga ggacccgctg       420
     gtgcgggtga tcagcgagcg ccagtaccgg gacctgcggg aggcgatgct ggagggcagc       480
     gggtcggcgg tgtggcggcg ggcggtgctg gcgctggcgg gcgacctggt ggacgtggtg       540
     gaggaggccg agcgggtgct ggccaccgct cccccggccc cgtccgccga cgaggacccg       600
     ctgctgggcg cgttccgcga gcggcaccgg gcggtggggg cgctgctggc cgaggtgcgc       660
     acggcgctgt cggccgagct ggtggccgtc gagcgggcct cggtgcgccc gtcggtggag       720
     gcgcagcgga cggcgctggg cgtggcctcc gcgctgcggg tgctcggtga gcggttcagc       780
     gacgggtgcc gggactacga ggcggcggtg gccggggcgc tggccccgga gcggcgcgcg       840
     ggcgcggcgg cgctggccga cgaggtggcg gcgctgtggg cggacgagcg ggcggtctcg       900
     gacctgctcg accgcttccg cccgctggag gaggagtacg cgccgctgcg gcacacgctg       960
     cggacgctgc gacgcgggtg caagtcgctg cagacggcgc tgctgctggt ggagcgggga      1020
     gcgggctga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page