(data stored in ACNUC7421 zone)

EMBL: CP001630.PE95

CP001630.PE95        Location/Qualifiers
FT   CDS_pept        103158..106223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0095"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: bpt:Bpet3362 HlyB/MsbA family ABC transporter;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydD; ABC transporter,
FT                   CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34069"
FT                   /db_xref="GOA:C6WDS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS4"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ACU34069.1"
FT                   /translation="MSFPGDLPARKKPGRGPLGALPKLSGSARRALVLCAFLAACTAVA
FT                   LVAQAVTLGTALADLVAGGSPLLWPIAATVLARALLAWATESAAARAAAGAKEELRAAL
FT                   LDRSLANGPEWITGRGPAELTALATKGLDALDAYFTRYLPALVTTAVVPPAVGLWILIS
FT                   DPTSAVLIAITIPLIPMFAILIGKFTEQKVAAVATTTEKLSARLHELVRALPVLTAFGR
FT                   AQAQAEAVRRTGDAHRRATMGTLRVAFLSALVLEIAASLSVALIAVGIGVRLVYGDMSL
FT                   ATGLIVLILAPDCYLPLRNAGAAHHASEDGLEAVRRVAEVVDSPRAEVTVPEAGETGVE
FT                   VRDLRVERRGGFAPDGLSFTVRPGQVHHLDAPSGRGKSTTIAALLGFLAPTSGEVRVRG
FT                   SVAWVPQRPAFAARTVAEELELTTGRVDHEVLRRVAAEHLVDRPVAELSTGERQRVAVA
FT                   RALSTGADVLLLDEPTAHLDPATAAKVMAAITAAAEGGAAVVLATHRLAEAADTDDDTT
FT                   AVRAADREPTTPRTPRPTRLLLGGAAIGTAALLSGVALTALSAYLIAKASTQPPILTLS
FT                   VITVGVRACALAKGVLRYLERLVTHDAAFRFADALRIDMWRNLRPGRAELTRLVDDTDT
FT                   VRDLVPRVLQPPLAAAGVGLAAVVLLTAIQPVAGLALAVLLLVGGLAAPLLAAALDRRA
FT                   TTALARGRRRVSEDVLTLLTAAPDLIAFRAEGRYRAGLAAVDAELARQTRRQAFGAGAA
FT                   TGLITLATGLAAVVCTALAGDVNPLLVPVLGLVPLALVETLSTLPAAAQHRAALREAYG
FT                   RVTERHPEVRPGTGPAKLENVDVRWPGAAEPVLRDFTLTPGVGERIAVVGPSGAGKSTL
FT                   FALLLGFLEPERGRVSRPERVAWCPQEPMLVSTTLRENLKLGDAHADDDRLREALVTAG
FT                   LPEWVDRLDTMIGPTLLSGGEAQRVALARALLHDADLVLLDEPTAHLDRPTAEALLDRL
FT                   DVALKGKTVVHITHRPEETRHADLVLSMRPAR"
     gtgagcttcc ccggtgacct tcccgccagg aaaaagccgg ggcggggccc gctcggcgcg        60
     ctgccgaagc tgtccggttc agcgcgccgg gccctggtcc tgtgcgcctt cctcgccgcc       120
     tgcacggccg tcgcgctcgt ggcgcaggcg gtcaccctcg gcaccgcgct cgccgacctc       180
     gtcgcgggcg gctcgccgct gctgtggccg atcgccgcga ccgtgctcgc ccgcgccctg       240
     ctcgcctggg ccaccgagtc cgccgccgcc cgcgccgccg ccggggccaa ggaggagctg       300
     cgcgccgccc tgctcgaccg ctcgctcgcc aacggcccgg agtggatcac cggtcgcggc       360
     ccggccgagc tgaccgcgct ggccaccaag gggctcgacg cgctcgacgc ctacttcacc       420
     cgatacctgc ccgccctggt gaccacggcc gtcgtgccgc ccgccgtggg cctgtggatc       480
     ctgatcagcg accccacctc cgcggtgctg atcgccatca ccatcccgct gatcccgatg       540
     ttcgccatcc tgatcggcaa gttcaccgag cagaaggtcg ccgcggtcgc gaccaccacc       600
     gagaagctct ccgcccggct gcacgagctg gtccgcgccc tcccggtgct caccgcgttc       660
     ggccgcgccc aggcccaggc cgaggcggtc cgccgcaccg gcgacgccca ccgcagggcc       720
     accatgggca cgctgcgcgt ggcgttcctg tccgcgctgg tgctggagat cgccgcgtcg       780
     ctgtcggtcg cgctcatcgc ggtcggcatc ggcgtgcgcc tggtctacgg ggacatgagc       840
     ctggcgaccg gcctgatcgt gctgatcctg gcccccgact gctacctgcc gctgcgcaac       900
     gcgggcgccg cccaccacgc cagcgaggat ggcctggagg cggtccgccg ggtcgccgag       960
     gtcgtggact ccccgcgggc ggaggtcacc gtccccgagg caggcgagac cggcgtggag      1020
     gtgcgcgacc tgcgcgtcga gcggcgcggc gggttcgccc ccgacgggct cagcttcacc      1080
     gtccggccgg ggcaggtgca ccacctggac gcccccagcg ggcgcggcaa gtccaccacc      1140
     atcgccgccc tcctcggctt cctcgccccc acctccggcg aggtccgggt gcgcggcagc      1200
     gtcgcctggg tgccgcagcg gcccgcgttc gccgcccgca ccgtcgccga ggagctggag      1260
     ctgaccaccg ggcgcgtcga ccacgaggtg ctgcggcggg tcgccgccga gcacctggtc      1320
     gaccggccgg tcgccgagct gtccaccggc gagcggcagc gcgtcgccgt ggcgcgggcg      1380
     ctgagcaccg gcgcggacgt gctgctgctc gacgagccga ccgcccacct cgacccggcc      1440
     accgccgcca aggtcatggc cgcgatcacc gccgccgccg agggcggggc cgccgtcgtg      1500
     ctggccaccc accggctcgc cgaggccgcc gacaccgacg acgacaccac cgccgtgcgc      1560
     gccgccgacc gcgagcccac caccccgcgc accccgcgcc ccacccgcct gctgctcggc      1620
     ggcgccgcga tcggcacggc cgcgctgctc agcggcgtcg ccctcaccgc cctgtcggcc      1680
     tacctgatcg ccaaggcctc cacccagccg ccgatcctca ccctgtccgt gatcaccgtg      1740
     ggcgtgcggg cctgcgcgct ggccaagggc gtgctgcgct acctggagcg gctcgtcacg      1800
     cacgacgccg cgttccggtt cgccgacgcg ctgcgcatcg acatgtggcg caacctgcgc      1860
     cccggccggg ccgagctgac ccggctggtg gacgacaccg acacggtccg cgacctggtg      1920
     cccagggtgc tccagccgcc gctggccgcc gcgggggtcg gcctggccgc cgtggtcctg      1980
     ctcaccgcca tccagccggt cgccggtctc gcgctggcgg tgctcctgct ggtcggcggg      2040
     ctcgccgcgc cgctgctggc cgccgcgctc gaccgccgcg ccaccaccgc cctggccagg      2100
     ggccgccgcc gggtctccga ggacgtgctg accctgctca ccgccgcccc cgacctgatc      2160
     gcgttccgcg ccgagggccg ctaccgggcc gggctcgccg ccgtcgacgc cgagctggcg      2220
     cggcagaccc gccgccaggc gttcggcgcg ggcgcggcca ccggcctgat caccctcgcc      2280
     accggcctgg ccgccgtcgt gtgcaccgcg ctggcaggcg acgtcaaccc gctgctcgtc      2340
     cccgtgctgg gcctggtgcc gctggcgctg gtcgagacgc tgagcacgct gcccgccgcc      2400
     gcccagcacc gcgccgcgct gcgcgaggcc tacggccgcg tcaccgagcg gcaccccgag      2460
     gtgaggccgg ggaccggacc cgccaagctg gagaacgtgg acgtccgctg gcccggtgcg      2520
     gccgaacccg tgctccggga cttcaccctg acccccggcg tcggcgagcg gatcgccgtc      2580
     gtcggcccgt ccggcgcggg caagtccacg ctgttcgcgc tgctcctggg cttcctggag      2640
     cccgagcgcg gccgggtcag ccgccccgag cgcgtcgcct ggtgcccgca ggagccgatg      2700
     ctggtgtcca ccacgctcag ggagaacctc aagctcggcg acgcgcacgc ggacgacgac      2760
     cggctccgcg aggccctggt caccgccggg ctgccggagt gggtcgaccg gctcgacacg      2820
     atgatcggcc ccacgctgct ctccggcggc gaggcccagc gcgtcgcgct ggccagggcg      2880
     ctgctgcacg acgccgacct ggtgctgctc gacgagccga ccgcgcacct ggaccgcccc      2940
     acggccgagg ccctgctcga ccggctcgac gtggcgctga aggggaagac cgtggtccac      3000
     atcacgcacc ggcccgagga gaccaggcac gccgacctgg tcctgtcgat gcggcccgcc      3060
     cggtga                                                                 3066
//

If you have problems or comments...

PBIL Back to PBIL home page