(data stored in ACNUC7421 zone)

EMBL: CP001630.PE96

CP001630.PE96        Location/Qualifiers
FT   CDS_pept        106220..107338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0096"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   GAF domain protein; SMART: GAF domain protein; ATP-binding
FT                   region ATPase domain protein; KEGG: pna:Pnap_3765
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34070"
FT                   /db_xref="GOA:C6WDS5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34070.1"
FT                   /translation="MTAVDPARVLAASTEITSLALEGDDPDAVLPLVVRHAAELAGADL
FT                   GLSMISADDGTLTVEASSAGPEPVGIVVSSRSSAARAARTGIPVVAADLVSDPRTAPFV
FT                   PKPLRGYGPFAVAPFGTKERRIGALAVYRRRGSAPFSPDTVDVLTAFAAHAGLAVVLAE
FT                   GTTARQRVAVYQERERIARDLHDVVIQRLFATGVQLDLLDRKLKLEGREAKRLADAVDQ
FT                   LDETIAEVRATVRALRGTMPEQLAHTDLVDSVRSEARTAGELLGFRPDVRIVGHFLDLA
FT                   PALADQARAALREALANVVRHAGAGWVGITVDKDAERLALEVSDDGCGIPDGVEKRGLR
FT                   HLEERALAMGGGCEISSSPSTGTTIRWHVPLA"
     gtgaccgccg tcgacccggc ccgcgtcctg gccgcctcca ccgagatcac ctcgctggcg        60
     ctggagggcg acgacccgga cgcggtcctg ccgctggtgg tccggcacgc cgccgagctc       120
     gcgggcgccg acctcggcct gtcgatgatc tccgccgacg acggcacgct gaccgtggag       180
     gcgtcctcgg ccggtccgga accggtcggc atcgtggtgt ccagccgctc ctcggccgcc       240
     cgcgccgccc gcaccggcat cccggtggtc gccgccgacc tggtcagcga cccgaggacc       300
     gccccgttcg tgccgaagcc gctgcgcggc tacggcccgt tcgcggtcgc cccgttcggc       360
     acgaaggagc ggcgcatcgg cgcgctcgcg gtgtaccgca ggcgcggttc ggccccgttc       420
     agcccggaca ccgtcgacgt gctcaccgcg ttcgccgcgc acgccgggct cgccgtcgtg       480
     ctcgccgagg gcaccacggc ccgccagcgc gtcgccgtct accaggagcg cgagcgcatc       540
     gcccgcgacc tgcacgacgt ggtgatccag cggctgttcg cgaccggcgt gcagctggac       600
     ctgctggacc gcaagctcaa gctggagggc cgcgaggcca agcggctggc cgacgccgtc       660
     gaccagctcg acgagacgat cgccgaggtg cgggccaccg tgcgcgccct gcgcggcacc       720
     atgccggagc agctcgcgca caccgacctg gtcgactcgg tgcgctccga ggcccgcacg       780
     gcgggggagc tgctggggtt ccggccggac gtgcgcatcg tcggccactt cctggacctg       840
     gcgcccgcgc tggccgacca ggcgcgggcc gcgctgcggg aggcgctggc caacgtcgtg       900
     cggcacgcgg gcgcgggctg ggtgggcatc accgtcgaca aggacgccga gcggctcgcg       960
     ctggaggtga gcgacgacgg gtgcggcatt ccggacgggg tggagaagcg cggcctgagg      1020
     cacctggagg agcgggcgct cgcgatgggc ggcggctgcg agatcagctc gtcgccgtcg      1080
     accggcacca cgatccgctg gcacgtgccc ctcgcctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page