(data stored in ACNUC7421 zone)

EMBL: CP001630.PE97

CP001630.PE97        Location/Qualifiers
FT   CDS_pept        complement(107555..108184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0097"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   xca:xccb100_3213 two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34071"
FT                   /db_xref="GOA:C6WDS6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34071.1"
FT                   /translation="MTIRVLLVDDHEVVRRGLRELLEDEADLKVVAEAGGVREAVVRAQ
FT                   ASKPDVAVVDMRLPDGTGVELCGKLQDLPGGPRCLVLTAFEDDEALVGAITAGASGYLL
FT                   KQVRGQDLVHAVREVAAGRSLLDPVTTSRVLERMRKPQEPDELATLTEQERRVLSLIGE
FT                   GLSNRQIAERLFVAEKTVKNHVTAVLSKLGMERRTQAAAWVARRGR"
     gtgaccatcc gggtactgct ggtcgacgac cacgaggtgg tccgcagggg gctccgcgaa        60
     ctgctggagg acgaggccga cctgaaggtc gtcgccgagg ccggcggcgt tcgggaggcg       120
     gtcgtgcggg cgcaggcgag caaaccagac gtagccgtag tcgacatgag gctgcccgac       180
     ggcaccggtg tcgagctgtg cgggaagctc caggacctgc ccggcgggcc gaggtgcctg       240
     gtgctgacgg cgttcgagga cgacgaggcg ctcgtcgggg cgatcacggc gggggcgtcc       300
     ggctacctgc tcaagcaggt gcggggccag gacctcgtgc acgcggtgcg ggaggtggcg       360
     gccgggcggt cgctgctgga cccggtgacg acctcgcgcg tgctggagcg gatgcgcaag       420
     ccgcaggagc cggacgagct ggccacgctg accgagcagg agcggcgggt gctgtcgctc       480
     atcggcgagg gcctgtcgaa ccggcagatc gccgagcggc tgttcgtggc ggagaagacg       540
     gtgaagaacc acgtgacggc ggtgctgtcg aagctcggca tggagcgccg gacgcaggca       600
     gccgcgtggg tggcccgccg gggccggtga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page