(data stored in ACNUC7421 zone)

EMBL: CP001630.PE98

CP001630.PE98        Location/Qualifiers
FT   CDS_pept        108245..108727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0098"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bca:BCE_4174 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34072"
FT                   /db_xref="GOA:C6WDS7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34072.1"
FT                   /translation="MLVRAIEEADRIVVGRLVLELWGTHTSVAHGQVFFPASLPGFLVE
FT                   QQDQVLGLLTYTTNDNLLEIVTIDALRRGRGVGTALLEAVVHRARQLGCNRIRLTTTND
FT                   NLDALRFYQRRGFRLTSLRSDAVRESRRVKPEIPSVGDYGIPIVDELDLERWVAPR"
     atgctggttc gcgcgatcga ggaagccgac cggatcgtgg tcggccgtct ggtgctggag        60
     ttatggggga cgcacacctc cgtggcccac ggacaggtgt tcttcccggc cagtctgccc       120
     ggattcctgg tggagcagca agaccaggtt ctgggcctgc tcacctacac gaccaacgac       180
     aacctgctgg agatcgtgac catcgacgcc ctgcggcgcg gccggggggt cggcaccgca       240
     ctgctggagg cggtggtgca ccgcgcgcgg cagctcgggt gcaaccggat caggctcacg       300
     accaccaacg acaacctgga cgcgttgcgg ttctaccagc ggcgcggctt ccggctcacg       360
     tcgctgcgct cggacgcggt gcgcgagtcg cgccgggtga agccggagat cccgtcggtc       420
     ggcgactacg ggattcccat cgtcgacgag ctggacctgg agcgctgggt ggcgccgcgc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page