(data stored in ACNUC7421 zone)

EMBL: CP001630.PE99

CP001630.PE99        Location/Qualifiers
FT   CDS_pept        complement(108789..109388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0099"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   dal:Dalk_0690 Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34073"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS8"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACU34073.1"
FT                   /translation="MAADTEGEINAPVVVPRLVLCAVDEPLTRAWAGVADGRTGVVVHR
FT                   GSVLDIVAEAVVSFGNSSGWLRTGVDELYARAFPHVEDQVRRAVLALHGGELPVGEALA
FT                   VPTCEPQPEWLVSAPTRRVLGERLPDDSVHPYLAARAVLRLWQTGRLDDGRLLRDVVRT
FT                   IAMPGLGTGVDGVSPWTCARQVAAAWDEVFSPIPRR"
     gtggccgccg atacggaggg tgagatcaac gctccggttg tagttccccg tctggtgctg        60
     tgcgccgtag atgaaccgct cacgagggcc tgggccggtg tggccgacgg ccgaacaggg       120
     gtggtggtgc accgcggttc ggtgctcgac atcgtcgccg aggccgtggt cagcttcggg       180
     aactcgtccg gctggttgcg gaccggcgtg gacgagttgt acgcgcgggc cttcccccac       240
     gtggaggacc aggtgcggcg ggcggtgctg gcgctgcacg ggggcgagct cccggtcggg       300
     gaggcgctgg ccgtgccgac ctgcgagccc cagcccgagt ggctcgtcag cgcgccgacc       360
     aggcgcgtgc tgggcgagcg cttgccggac gacagcgtgc acccgtacct cgcggcgcgc       420
     gcggtcctcc ggctgtggca gaccgggcgg ctcgacgacg gcaggctcct gcgcgacgtc       480
     gtgcgcacga tcgccatgcc gggactggga accggagtcg acggagtgtc gccgtggacc       540
     tgcgcacgtc aggtcgcggc tgcctgggac gaggtgttca gcccgatccc caggcgctag       600
//

If you have problems or comments...

PBIL Back to PBIL home page