(data stored in ACNUC7421 zone)

EMBL: CP001658.PE10

CP001658.PE10        Location/Qualifiers
FT   CDS_pept        complement(13235..13660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00010"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23031"
FT                   /protein_id="ACT23031.1"
FT                   /translation="MQQTAWAPRTSGIAGCGAGGVVMAIASVTLVTDTPGRVLTGVAAL
FT                   GLILFASATWRARPRLAITPDGLAIRGWFRTQLLRHSNIKIIRIDEFRRYGRLVRLLEI
FT                   ETVSGGLLILSRWDLGTDPVEVLDALTAAGYAGRGQR"
     atgcagcaaa cagcatgggc gcctcgcacc tcgggaatcg ctggttgcgg agccggggga        60
     gtcgtgatgg ctattgcgtc tgtgacctta gtcacagata cgcccgggcg ggtgttgacc       120
     ggagttgccg cgctgggtct gatcttgttt gcgagcgcca cttggcgcgc acgtccaagg       180
     ctggcaatta cccccgacgg cctggcgatc cgaggttggt tccggacgca gctattacga       240
     cattccaata tcaagatcat ccgaatcgac gagtttcgcc gttacggccg cctggtgcgc       300
     ctgctcgaga tcgaaacggt cagcgggggg ctgctgattt tgtcccgctg ggatctcggc       360
     accgacccag tggaggtgct cgatgcgctt accgctgccg gttacgccgg tcgcggccaa       420
     aggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page