(data stored in ACNUC7421 zone)

EMBL: CP001658.PE107

CP001658.PE107       Location/Qualifiers
FT   CDS_pept        122448..123962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23128"
FT                   /protein_id="ACT23128.1"
FT                   /translation="MTPVTTFPLVDAILAGRDRNLDGVILIAAQHLLQTTHAMLRSLFR
FT                   VGLDPRNVAVIGKCYSTHPGVVDAMRADGIYVDDCSDAYAPHESFDTQYTRHVERFFAE
FT                   SWARLTAGRTARVVLLDDGGSLLAVAGAMLDASADVIGIEQTSAGYAKIVGCALGFPVI
FT                   NIARSSAKLLYESPIIAARVTQTAFERTAGIDSSAAILITGAGAIGTALADVLRPLHDR
FT                   VDVYDTRSGCMTPIDLPNAIGGYDVIIGATGATSVPASMHELLRPGVLLMSASSSDREF
FT                   DAVALRRRTTPNPDCHADLRVADGSVDATLLNSGFPVNFDGSPMCGDASMALTMALLAA
FT                   AVLYASVAVADEMSSDHPHLGLIDQGDIVASFLNIDVPLQALSRLPLLSIDGYRRLQVR
FT                   SGYTLFRQGERADHFFVIESGELEALVDGKVILRLGAGDHFGEACLLGGMRRIATVRAC
FT                   EPSVLWELDGKAFGDALHGDAAMREIAYGVARTRLMHAGASESLMV"
     gtgacgcccg tcacaacgtt tcctctcgtg gacgcgatcc tcgctggtcg cgaccgcaac        60
     cttgacggcg ttatcttgat cgccgcccaa cacctgctgc aaacaacgca cgccatgctg       120
     cgttcgctat ttcgggtcgg cctcgatccg cgcaacgtcg cggtgatcgg caagtgctat       180
     tccactcacc cgggagttgt cgacgcgatg cgggccgacg gcatctatgt cgacgattgc       240
     agcgacgcct acgcacccca cgaatcattc gacacccagt acacccgcca cgtagaacgg       300
     tttttcgccg aatcctgggc gcggcttacg gccgggcgta cggctcgtgt cgtgctcctc       360
     gacgacggcg gatcgctgct agccgtcgcc ggcgccatgc tcgatgcgag cgccgacgtg       420
     atcggaatcg agcagacgtc cgccggctac gccaaaatcg tcggttgtgc gctggggttt       480
     cccgtcatca acatcgcccg ctcgtcggca aagcttctat acgagtcgcc gatcatcgcc       540
     gcacgcgtga cacagacggc attcgagcgc accgcgggca tcgactcaag cgcagcgatc       600
     ctgatcaccg gcgcgggcgc aatcggcact gccctggccg atgtgctgcg tccgctgcat       660
     gaccgggtgg acgtgtacga cacgcgctcc ggctgtatga cgcccatcga tcttccgaat       720
     gcgatcggcg gctatgacgt gatcatcggt gccaccggcg ccaccagtgt gcccgccagc       780
     atgcacgaat tgctgcgccc cggcgtattg ctgatgtcgg cgtcttcgtc cgatcgcgag       840
     ttcgatgccg tcgcgttgcg tcggcgcacg acgcccaatc ctgactgcca tgccgacctc       900
     agggtagccg acggcagtgt cgacgctacc ttgttgaatt cgggcttccc ggtcaacttt       960
     gacggttcgc ccatgtgcgg cgatgcgtcg atggcgctca cgatggcgtt gttggcggcc      1020
     gcggtgttgt atgcgtcggt cgcggtcgcc gacgaaatgt catccgatca tccgcatctc      1080
     gggctgatcg accagggcga catcgtggca tcgtttctga acatcgacgt cccgctccaa      1140
     gctctcagcc ggctaccgtt gctttcgatc gatgggtatc gccgccttca ggtgcgctcc      1200
     ggctatacct tgttccgcca aggtgagcgg gccgaccact tctttgtcat cgaatccggc      1260
     gagcttgagg cgctcgtcga cgggaaggtc atccttagac tcggtgccgg agaccacttc      1320
     ggcgaggcgt gtttgctcgg tggcatgcgg cgcatagcga cggtgcgggc atgtgagcca      1380
     tcggtcctgt gggagctcga cggcaaggct ttcggcgacg cgctgcatgg ggacgctgca      1440
     atgcgtgaga tcgcctacgg tgtcgctcgc acccggctca tgcacgccgg cgcgtccgag      1500
     tccttgatgg tgtaa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page